ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_061010 ()

26S protease regulatory subunit 8, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11227

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL2345c tat-binding protein homolog
  • PBANKA_146180 tat-binding protein homolog, putative
  • PY02897 tat-binding protein homolog
  • PVX_101335 26S protease regulatory subunit 8, putative
  • PCHAS_146410 tat-binding protein homolog, putative
  • PKH_146620 tat-binding protein homolog, putative
  • TGME49_061010 26S protease regulatory subunit 8, putative
  • NCLIV_026270 26S proteasome regulatory subunit S4 like AAA ATpase, related
  • cgd6_920 26s protease regulatory subunit 8, putative
  • Chro.60119 hypothetical protein
  • CMU_027300 26S protease regulatory subunit 8, putative
  • TP02_0893 26S proteasome regulatory subunit, putative
  • TA15700 26S proteasome ATPase subunit (Rpt6A homologue), putative
  • BBOV_I000480 tat-binding protein-like protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_061010 26S protease regulatory subunit 8, putative
MSALAGPLRPPCATEGEDGPSSGLQTYYEQKIDNLQRVINAKTQDKRRLEAQRNELNAKVRELRDELQVLLEPGSYVGEV
VKVMGRNKVLVKVNPEGKYVVDVAKNIDLSQCTVNTRVALLNDSYRLHKILPTKIDPLVSLMKVEKVPESTYEMVGGLEQ
QVKEVKEVIELPIKHPELFESLGISQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGGELVQKYIGEGSRMVRELFV
MAREHAPSIIFMDEIDSIGSQRTEGEHGDSEVQRTMMELLNQLDGFESTQNIKVIMCTNRIDILDDALLRPGRIDRKIEF
PNPNVDARTEILKIHSRKMNLMRGIDMRKIAQEMNGSSGAEVKAVCTEAGMFALRERRMFVTQEDFEMAVAKVMKKDAEK
NMSLRKLWK

Gene-Specific Links for TGME49_061010

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins