ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_060820 (ISP1)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
apical cap of inner membrane complex during early in endodyogeny and late in endodyogeny and non-dividing tachyzoite and shortly after invasion of tachyzoite and tachyzoite

Who localised this protein by microscopy?

Straub, K. W., Peng, E. D., Hajagos, B. E., Tyler, J. S., Bradley, P. J.
The moving junction protein RON8 facilitates firm attachment and host cell invasion in Toxoplasma gondii. (2011 Mar, PLoS Pathog) PubMed / full text
   more detail about this publication

apical cap of inner membrane complex during shortly after invasion of tachyzoite
  • "The orientation of the parasite is shown by costaining with anti-ISP1 which detects the apical cap of the IMC"
  • Microscopy type: fixed light
  • Microscopy method: fixed light
  • Strain: RH ku80- hpt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical cap of IMC during newly invaded tachyzoite
  • Other genes localised in this publication: hypothetical protein, hypothetical protein

Beck, J. R., Rodriguez-Fernandez, I. A., Cruz de Leon, J., Huynh, M. H., Carruthers, V. B., Morrissette, N. S., Bradley, P. J.
A novel family of Toxoplasma IMC proteins displays a hierarchical organization and functions in coordinating parasite division. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

apical cap of inner membrane complex during early in endodyogeny and late in endodyogeny and non-dividing tachyzoite
  • "ISP1 localizes to the apical cap portion of the IMC, while ISP2 localizes to a central IMC region and ISP3 localizes to a central plus basal region of the complex."
  • Microscopy type: fixed light
  • Microscopy method: monoclonal antibody
  • Strain: RH hpt-
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: apical cap of IMC during before the onset of endodyogeny and early in endodyogeny and late in endodyogeny
  • Other genes localised in this publication: hypothetical protein, hypothetical protein, caltractin, putative

Tran, J. Q., de Leon, J. C., Li, C., Huynh, M. H., Beatty, W., Morrissette, N. S.
RNG1 is a late marker of the apical polar ring in Toxoplasma gondii. (2010 Sep, Cytoskeleton (Hoboken)) PubMed / full text
   more detail about this publication

apical cap of inner membrane complex during tachyzoite
  • "Labeling with an antibody to the IMC sub-compartment protein ISP1 shows that RNG1 staining is anterior to ISP1, a component of the apical membrane cap region of the IMC (Beck et al., submitted, Figure 3a). "
  • Microscopy type: light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical membrane cap during tachyzoite
  • Other genes localised in this publication: A common gene for all genes not assigned to a gene model

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23348

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_060820 hypothetical protein
MGAVSSCCAVEESEERQVMQQENAGKTKGEKSRYERKKGDKSGKRSPSHRASHAASAPQVTAADIEDLHRRLLAGMAVLV
LLQDGTRLQCILHYNEADSSLSISCEDKVRVIPLSDIKALLHTRDQLQRVETKANLVDDESCVALHLLESGNCIPLRFDG
VKDKTCFVDLLKKLKA

Gene-Specific Links for TGME49_060820

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins