ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_060460 ()

oxidoreductase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10085

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFF1265w oxidoreductase, short-chain dehydrogenase family, putative
  • PBANKA_112490 oxidoreductase, putative
  • PVX_114410 oxidoreductase, short-chain dehydrogenase family, putative
  • PCHAS_112440 oxidoreductase, putative
  • PKH_112320 putative oxidoreductase, short-chain dehydrogenase family, putative
  • TGME49_060460 oxidoreductase, putative
  • NCLIV_026580 hypothetical protein
  • cgd4_2270 oxidoreductase, short-chain dehydrogenase family, putative
  • Chro.40258 ENSANGP00000010899
  • CMU_017270 retinol dehydrogenase family protein
  • TA10920 short-chain dehydrogenase/reductase (SDR family member), putative
  • TA10925 short-chain dehydrogenase/reductase (SDR family member), putative
  • BBOV_III007020 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_060460 oxidoreductase, putative
MKGKVAVVTGGNAGIGMETTRQLALWGVHVLVGCRRVDDVQKIADQVSQEHARNKETAKSKKLPAPVTPGEIRGFYLDLC
DFETVRRFAVWAHAESRGKIDILVNNAGLMSTDKLSMDKNTGFERHFVTNHLGPFLLTDLLLPAVKAAHGRVITISSAAH
ITRNPKFRSLDAALSPEAAERVASALGKPLHELQGEPITEKNYDSKVMYGTTKMANLWFTKELQRRLAQDPKCRVTAYAA
HPGLVGTGLMLRYAEGSVHWYTPIFEAIYSLIAPLVLKLPQQGAATQLLLCVSDKEELEPGAYYKDGTTNWVDYLAHDVE
RQKELWAVSEIVCGMR

Gene-Specific Links for TGME49_060460

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins