ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_060310 (ABC.B1, P-gp)

ATP-binding cassette protein subfamily B member 1, a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during tachyzoite
acidocalcisome and intravacuolar tubular network during extracellular tachyzoite

Who localised this protein by microscopy?

Bottova, I., Sauder, U., Olivieri, V., Hehl, A. B., Sonda, S.
The P-glycoprotein inhibitor GF120918 modulates Ca2+-dependent processes and lipid metabolism in Toxoplasma gondii. (2010, PLoS One) PubMed / full text
   more detail about this publication

acidocalcisome and intravacuolar tubular network during extracellular tachyzoite
  • "In support of a potential role of P-gp in Ca2+-mediated processes, immunoelectron and fluorescence microscopy showed that T. gondii P-gp was localized in acidocalcisomes, the major Ca2+ storage in the parasite, at the plasma membrane, and in the intravacuolar tubular network."
  • Microscopy type: Light, EM
  • Microscopy method: monoclonal antibody
  • Strain: RH
  • Gene model mapping comments: blast from AAZ04382, annotation doesn't match
  • Localisation record: acidocalcisomes and intravacuolar tubular network during extracellular tachyzoite
  • Other genes localised in this publication: H+-translocating inorganic pyrophosphatase TVP, putative

Schmid, A., Sauvage, V., Escotte-Binet, S., Aubert, D., Terryn, C., Garnotel, R., Villena, I.
Molecular characterization and expression analysis of a P-glycoprotein homologue in Toxoplasma gondii. (2009 Jan, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "The TgABC.B1 gene is a single copy gene transcribed into a full-length mRNA of 4.3kb and expressed as a protein of approximately 150kDa, which cellular localization revealed a membrane-associated labelling in tachyzoites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from EU213065, annotation matches
  • Localisation record: punctate parasite plasma membrane during tachyzoite
  • Comment: gene model inconsistent There is some polymorphism to consider perhaps?
  • Other genes localised in this publication: SRS29B (= SAG1, P30)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10058

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_060310 ATP-binding cassette protein subfamily B member 1
MATSDDSSTGGAGNRLLEGKEVGIDPSPSQTTGKQKRYLMAPFHFVSGTEIGVLVVGVVFALGAGAAMPGFISIFGDMMA
ALNTNTDMVPYAKLLAILGVVALFCGWVAAGSFEYLCDRQAGKFKLELFSSILRQELGWFDTHDAGALSSQIDSNTATIR
TAVGLKCATALQFFSTCVGGFVVAFWRSWKMTLIVSATLPCVAAGGAFLAWALRYSQTAVSDAYREAGSVAEEALGNIRT
VISLGGEDRLAAAYTERLKRAEKAAIKGGVFTGSAFGAMMACVFLMYALGFWYAGQVISDGLRDLQAAIAMLPGTTVLDA
GSLEFQGGDAIVVLICVMVSAFSIGQIIPLFGDYMKAVEAANDLLEIINRKSQLDPLDESGLKDVNLTGDIVYENVTFAY
PSRPEKTVLKDLNLRIPAGKSVALVGGSGCGKSTIVQLLQRQYEPSAGTVRVGNTPLKEINLATLREGLGVVSQEPRLFS
ATVEENIALGSRSRVTHAEVEAAAQKANAAGFISDFAEKYETHCGSRGSQLSGGQKQRVAIARALIRHPSILIFDEATSA
LDNASERVVQAALDRLIESTGVTTIIIAHRLSTIRRADLIVVLGQRDDAGGSAVVQQGSHEELMKDESGLYFSLVQSQLA
GLHGGDEEKEEEASTEVLVETTTNASVAAAQSMEKHPSFPLTSRRDSVTSSISRISEHLLGTDVTDATRRCLCLKKKVAP
RDPHAPPPVSKSRIFGLALRYWPVYIVTLIAAACSGAVFPAYSVMFSRFIAVFFRLDPDEVSDEANKWALAFVCLAISTF
VIEWVKFTGIEYMGSKVTADLRSRAFLQTIHQDVAFFDDPKNSVGALMSTLSSDVLLVKSGSCGNPMALAAVISAITTGC
AISFVSDWRLAAVLVTSLLVLVPANIMEERLMHTHDHVSKDSKDRDESLRCPEQVLIEAVGGIRVVSAFGLEQYFVELYK
KCLHLDPVSQAKSAATVGFFWGFSQGAQFAFNALAMWYGGELIKEGAAATDIMQATFGIMFASMSVGQTVLYSTDAARAQ
LAAERVFALIDRTSAIDTRDTGGRKFSDNANTGVDIAFTDVQFRYPTRTTLPVYRGLSFTIKAGESVALVGPSGCGKSTA
IQLLERFYDLQSSVAANACDAKDSRRKTKGGGSITFAGTELRDANVSSLREQMGFVGQEPVLFNMSVEDNIRFSCPDASQ
TDIIEAAKQAQADSFIRSFPQGYKTIVGSGGSQLSGGQKQRIAIARALVRKPRLLILDEATSALDPESERQVQKTLDELM
EKGHKHSTIIVAHRLSTVRNANKIVVLSNEDGRGSRVVEVGTHEELMKLKNGVYRQLVNMSRYSA

Gene-Specific Links for TGME49_060310

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins