ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_059660 ()

orotate phosphoribosyltransferase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10245

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF10_0225 orotidine monophosphate decarboxylase
  • PFE0630c orotate phosphoribosyltransferase
  • PBANKA_050740 orotidine-monophosphate-decarboxylase, putative
  • PBANKA_111240 orotate phosphoribosyltransferase, putative
  • PY01515 putative orotidine-monophosphate-decarboxylase
  • PY04605 URA5
  • PVX_080605 orotate phosphoribosyltransferase, putative
  • PVX_111555 orotidine 5' monophosphate decarboxylase, putative
  • PCHAS_050750 orotidine-monophosphate-decarboxylase, putative
  • PCHAS_111200 orotate phosphoribosyltransferase, putative
  • PKH_060740 orotidine-monophosphate-decarboxylase, putative
  • PKH_101980 orotate phosphoribosyltransferase, putative
  • TGME49_059660 orotate phosphoribosyltransferase, putative
  • TGME49_059690 orotidine-monophosphate-decarboxylase, putative
  • NCLIV_027100 orotidine-monophosphate-decarboxylase, putative
  • NCLIV_027130 orotate phosphoribosyltransferase, putative
  • TP01_0073 orotate phosphoribosyltransferase, putative
  • TP01_1133 orotidine 5-phosphate decarboxylase, putative
  • TA16510 orotidine 5'-phosphate decarboxylase, putative
  • TA19940 orotate phosphoribosyltransferase, putative
  • BBOV_IV000530 orotate phosphoribosyltransferase
  • BBOV_IV011760 orotidine 5'-phosphate decarboxylase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_059660 orotate phosphoribosyltransferase, putative
MSSGNLSVSRSRTLRKVLAGPPGETDEYQGRQLDELQKALLRLAYNHGALKFGEFKLKSGRTSPFFFNAGMFGNGQAMEL
ISKAYATEIVRSGVEYDVLFGPAYKGIPIVACTAMSLNRVYSQPAPFIYDRKEAKDHGEKGVLVGALNQLEPKQIPGTTD
KYRPARVLLLDDVLTSGTAIRGNMKLLQELQHTVEVAGIFVLLDRQERVSEDADLSAAEQLEETYKTKVFSVLNIMDLLL
FLEELISSGDHLEPRETLQKARNDILEYRRKYGVTDELPTDVM

Gene-Specific Links for TGME49_059660

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins