ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_059530 (GalNac)

UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T1, putative, a gene from Toxoplasma gondii

Compiled localisation
trans-golgi network during extracellular tachyzoite and intracellular tachyzoite

Who localised this protein by microscopy?

Harper, J. M., Huynh, M. H., Coppens, I., Parussini, F., Moreno, S., Carruthers, V. B.
A cleavable propeptide influences Toxoplasma infection by facilitating the trafficking and secretion of the TgMIC2-M2AP invasion complex. (2006 Oct, Mol Biol Cell) PubMed / full text
   more detail about this publication

trans-golgi network during extracellular tachyzoite and intracellular tachyzoite
  • "various organellar markers, including TgM2AP, micronemes (B and B'); GRASP-mRFP, Golgi cisternae (C and C'); TgGalNac-YFP, TGN (D and D'); and TgRab51-HA, TGN/early endosome (E and E')."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: RH
  • Gene model mapping comments: annotation matches
  • Localisation record: TGN during extracellular tachyzoite and intracellular tachyzoite
  • Other genes localised in this publication: MIC2-associated protein M2AP, Rab 5, hypothetical protein, apical membrane antigen 1, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12174

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • TGME49_118730 UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T3, putative
  • NCLIV_010830 UDP-N-acetyl-D-galactosamine:polypeptide N- acetylgalactosaminyltransferase T3, putative
  • NCLIV_027240 UDP-N-acetyl-D-galactosamine:polypeptide N- acetylgalactosaminyltransferase T1, putative
  • NCLIV_067480 UDP-N-acetyl-D-galactosamine:polypeptide N- acetylgalactosaminyltransferase T5, putative
  • cgd5_690 extracellular protein with a ricin domain and a family 2 glycosyltransferase domain
  • Chro.50322 UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T3
  • Chro.70461 UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T1
  • CMU_014290 glycosyl transferase, group 2 family protein
  • CMU_041230 glycosyl transferase, group 2 family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_059530 UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T1, putative
MDDSSDTVTGKNRGDACGMLSRIFPPSWRPASPRSRSSSLPSYPVSRCVCGALLTTCLLIIFMVLFLVPVSLSPSAPAAL
WRSRGGLPSWLVGAPGLGAVDGEFSGNSDILGGIRAIGLPQIQDWKPLQRRERKVTQLGYEGGQYGDAPAYIVEPELVHE
VNPGADEDRLHGLVGILDDGTLAWSPKPIFLKLTKEQKRLAHKGYCFNTKVSDSLSLDRSVPEFASNYCRDQRLLFDNMT
PPSAEQKWKQTRELSKAQSPQLSATDGKASSAVVPRATDGSLPDTSVVIVFYNENLSVLLRSIHSVLNRTPPSLLKEIIV
VDDFSDRQTHPWLGKQLEDYISGTLPKTRLLRLLQRRGLMGARAAGAAAASAETVTFLDSHIECLPYWLQPLLFHVKQDW
RRIAMPLIPTIDADNFRIKDGGLKTLAFTWGMSHYHIHDKIRHRIEELGQDEAAKNPDAPTMSPIMAGGLFTITKAWWDT
LGGYDKEMQIYGGEEFEISFKTWMCGGSLHLVPCSRVGHVFRSNEFWQGQVYTVPGALIHRNKLRTAHVWMGEYARIVEL
VIPRLPQDKPLGDLTELKALRDRLKCKDFNWYLKNIYPELEPPNLAHAMTGAMRNPKFNCCLDTLTTKNQEIGVYPCHFE
HGTQAFLYGKDTHMLRVAEHNFELCVYGNPAKRRLPERSCTEDFSGQGLSRYWLYKEDTKQMQLLDAENKDIHPDNLCMQ
AVQIQTPKSPFDLVLRKCDPSREEQHFVFVP

Gene-Specific Links for TGME49_059530

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins