ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_059260 (FtsH1)

cell division protein, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast membrane during tachyzoite

Who localised this protein by microscopy?

Karnataki, A., DeRocher, A. E., Feagin, J. E., Parsons, M.
Sequential processing of the Toxoplasma apicoplast membrane protein FtsH1 in topologically distinct domains during intracellular trafficking. (2009 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apicoplast membrane
  • "In the protozoan Toxoplasma gondii, FtsH1 is localized to membranes of the apicoplast, a relict chloroplast present in many apicomplexan parasites. "
  • Microscopy type: Light
  • Microscopy method: epitope tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast membrane
  • Other genes localised in this publication: -

Karnataki, A., Derocher, A. E., Coppens, I., Feagin, J. E., Parsons, M.
A membrane protease is targeted to the relict plastid of toxoplasma via an internal signal sequence. (2007 Nov, Traffic) PubMed / full text
   more detail about this publication

apicoplast membrane during tachyzoite
  • "Although the protein lacks a canonical bipartite-targeting sequence, epitope-tagged FtsH1 colocalizes with the recently identified apicoplast membrane marker APT1 and immunoelectron microscopy confirms the residence of FtsH1 on plastid membranes."
  • Microscopy type: EM, Light
  • Microscopy method: epitope tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: blast from EU118280. Annotation doesn't match and gene model is missing much of the 5' part
  • Localisation record: apicoplast membrane during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25827

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_059260 cell division protein, putative
MFVSFLTFRLLHSLHDGADGVDIDSTDYEGVDDDGIRPDGSYGNHMMHNTTDSSSGSNVTNSETALVPPQPTFPPLTFND
LAGLTEAKTELQEVVQFLRDPSKFERLGARLPKGVLLVGPPGTGKTALARAVATEAGVPYFYASGSEFVEIYVGQGARRV
RGLFSYARNHSPCIIFLDELDAVGGRRQASAGPGAGNREHDQTLNQLLVEMDGFNQASRIVVLAATNRVDTLDPALLRPG
RFDRIVHVSLPDVAARELILQKYLQRVPVELPTESHEGTVSGFSTLVNAGDERANAAQGKSPAPLASPHSRSSSDKREEK
DRSSGRFPRSEEGKKEEVEPETYRQRPGPQSGREKAAFSDNTAIGDKEGSEDSEAEHEKKPGLTQVHKDLAKQIAKITPG
FSGAELENLVNEAALLAARADKEIVTLQELQEARDKVTMGPARKTRVMSAYQRQLTAYHEAGHAIIAFYLQPYADPIHKA
TIVSRGSALGFVEQVPLEDRYGHGVAQLEARLCVCMGGRVAERLIFGRDALSNGASSDIETATRMAYVMVTEWGMSEKLG
PLSYKVHGRSRRAFISSETANLVEEEVKQLVITAERKAEKLLRRHRKQLREVALQLLEKETLSGEEISEILDPSGSYRTK
VERLRTRMQQGEQPSFLQRLVVQLKRGFQWLFLPRDQTEFAAVEADKQLKTQEETEKKNGSTNEAPKKTGDGDDDESGNS
RREMQEAAATREAEPYRNDQDRRDRHGDEDHLFADVNEISAKQPQISGATRTGHEDGHSESTTHLRCSRGNVAEGQHCSD
LSVEAQVPEPFFPVRKHSHQVGEETGREHFSRYAEVKSLPSNPMVPRGKLDSEAASDGEAKIRLRDGEAGLPHGDLVQDW
THRTPRSVQRHEAFTLEDDFRKKGNSSEREDVFSRGIGRRGAEVQSASLVSQQQCCESGTKNCANSQARVHSRRTKRVQQ
QWQLTPWGLGLSTITRDE

Gene-Specific Links for TGME49_059260

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins