ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_059200 (NHE1)

Na+/H+ antiporter, putative, a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during intracellular tachyzoite and tachyzoite

Who localised this protein by microscopy?

Arrizabalaga, G., Ruiz, F., Moreno, S., Boothroyd, J. C.
Ionophore-resistant mutant of Toxoplasma gondii reveals involvement of a sodium/hydrogen exchanger in calcium regulation. (2004 Jun 7, J Cell Biol) PubMed / full text
   more detail about this publication

parasite plasma membrane during intracellular tachyzoite and tachyzoite
  • "TgNHE1 is localized in the plasma membrane"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: Blast from AY485268.1, annotation matches
  • Localisation record: plasma membrane during tachyzoite
  • Other genes localised in this publication: -
  • "TgNHE1 is localized in the plasma membrane"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH HXGPRT-, GAD1.7
  • Gene model mapping comments: blast from AY485268, annotation matches
  • Localisation record: plasma membrane during intracellular tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10194

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_059200 Na+/H+ antiporter, putative
MGTEKSRRESADREGPASPLLVQYKENATCSGRKEETEAKEEEAELGCWRVHDGTRAAREEESLSFSPPPPSACGTHHSA
RLDVTKETGTSPRASSASRPSGTPAGSASSDDGDTSLPPRGVGHAEPQDFPGVAATAVAPPGGVSFRRRQPYGSEKGEPN
KSANGADYGNETGKAVKWRKAPRTSSHKGETMNALALLGAPSASRDSARWSSSESSRSWASPEKTEFSVTRACLPLTALL
LLIFSSLLFKALPNYLGRPIERSHAGFGSTAQQVLANLVFQSAEPSAASAFSPEDLPASFAVPHHSVGPRRLAAETGKET
AAPVSGTGSGAGSRCDEPPEEENPIASTLSFFCFLFFAAVFLQWLVSKIPSYPPPVSVVWFVFGMVAYGVASIPSLLPPQ
TQEKARLEATEGMDGHARAAESNTGIGEVPLIGHNSLQTGILEMRVIDSNVVYFVLVPILLYEATQSINWHKFKRFLAGG
LLLAVLGVAVQVGILGVMFYYTYMQQYVPNTADSDQSPLTAAFLLASTLSSTDPVAVLSVLNAVNASDKLCTMFDGESLI
NDGSAVLLFQFFFYLLQGFSETPLSTFIMFMKLLFAGPALGCFLGFLVYLWLNCFRKYPMTQCLAVITVCYIAYFVAEVA
FSLSGPLTAVCYGLFIKSYGHIALDREAQHKHHTLVEGLGLMANCAIFIISGIVTYGMMSSVFHRSDGGTYWLHLFLTYI
FLNVARIFMIALFSPFLRRTGYGLSWKEAILLFWGGLRGGIVLALGLRIERDGNLESELTKALSFFISGSVFLILVVHGM
TFELLYRWLNPYPPKPFRRVYLEAVMKMIDYQYMEEKQALNNHWLFNGTDVLVYADKVVPALGWRKVDRLGNLNLKAPDI
SVALSCLHEASFNTWVVPTAYSTGPAMTVVKRMATAAVLPPEARATLALEQGEALREEAEKREDEKERVGALRAAFSMAL
DQVRDGDRAGGPGGRELPETTAYGSSSADPRLLSPASSGLGLPRDSAFGSGSLGRGLSRSAGEKSMFLAPPGSSGSILLT
PQSAAPDGTHAGGDSDREVDKRVATRAAEDDKEPKGVAEGLPNTFLGSREVERGAESAQLSPRYSVKSQALPVEAETNQS
PVISQAPSVVFHSQPVGHTDGGLSHRTSMIGPRQREPGRASGETDARLKNYHKEKQAHTLAALSQGLKPELGVGIGVGST
FDPKFNLRLIEHATTMGRMAENLRETGKTGEEAVAAASSSRRRKARGLRLHSRREADEAEKKANSTDSSSSGSETDDLDN
KPVEVIVEGEDPQTKLPVYRLTSMRTQRLTFDTDGRGAPAHRRDEGDSDPEAAADWRDSRHHVGPVGWANALLDTVRFRR
MRTHAAIDSGVGEGTRSPVLSRGHTSVLHSRRRRHQEDEVEDSGAWEKKVRAAGRLAVPLVIPARRKAMSVLGRGGDESP
RTLAKKKEGKDVGDDGSTSGEGLLSTRKVEDGNQGAADEAGEEDDVLKDFPRYSDEDGSDDGRAPTRFDTDATLVFHHKD
LVPGIQKRKSKRKGVTRRMQSLLHLPHRSRRGSDASRMNMLSPPVSPRPGHAGENELPPGASSPATLAAPGGVRSEKERK
ERDEAYTPASVTPPSAVRSPDSGAGGSAAPESGEEGRWPLKLLAKSVDKRQDGDPDKDRGRAGGHLGIPRASSFRRTSEK
SASAVAADGDASGDQGKTLVPPLVLPPDNGEKAHSRDLSGGSGRRGSGGTAPRRTVWSRKGRHGEKEKRILIRGRRPVLR
GQKDRERSKSTDFDAFNRNPSGTGAIGGRDTRSEGAQSADEADRLADLKRSLSLGSSESYFEIPATPRRGSALSPDRGGR
EVRTMSPRTTQRAGSRRKVLRKEREGELYLMIFNACREMYHRLYHKHCIGGSALLSLNTSLDLSNDFAVGKVRQNPIRAW
AEVLQEDEHGAGEAGGKRGPKKRTLQTLTGFEYEWSVLQSRLHCMQEQQQGWCGLRAAPFCCGRRVPSAFMRSLLNSGAC
QSDLEQILAFVDVHEELLEKGGKNMQQLMGEELLASYNRQILSAKRFVLYIRDCYPDSFRVAICKIAATLLLNLKTKLVK
DTAQKGLVLEEDKEKLLRILDEQQFRLSRFRPCFIFIRPQSCMPSAMGHVLAFGARSHSASSSSGATFSRGGRDLLALRS
TSSDGASEKGKDADQTCNDAYDGWAGAEDEGGRGVMRRDFQEQSPRFAGATALPSLWEGRDNQDDERRASGDRRRFSSVV
RMMDSGRHGQCPPVDGGSHSFADGCDARELDTSTVQVCGTPASFQNAV

Gene-Specific Links for TGME49_059200

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins