ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_059020 (BAG1)

bradyzoite antigen, putative, a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during bradyzoite
during bradyzoite and not enteric and not merozoite and not sporozoite and not tachyzoite
cytoplasm and not cytoplasm and not nucleus during bradyzoite

Who localised this protein by microscopy?

Gordon, J. L., Beatty, W. L., Sibley, L. D.
A novel actin-related protein is associated with daughter cell formation in Toxoplasma gondii. (2008 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

parasite plasma membrane during bradyzoite, during not tachyzoite

Dautu, G., Ueno, A., Munyaka, B., Carmen, G., Makino, S., Kobayashi, Y., Igarashi, M.
Molecular and biochemical characterization of Toxoplasma gondii beta-hydroxyacyl-acyl carrier protein dehydratase (FABZ). (2008 May, Parasitol Res) PubMed / full text
   more detail about this publication

parasite plasma membrane during bradyzoite
  • "Furthermore, brain tissue sections from infected mice incubated with polyclonal anti- TgFABZ antibody showed localized staining in the T. gondii (Fig. 3c). On the other hand, brain sections incubated with polyclonal anti-BAG1 antibody (used as positive control) stained the T. gondii cyst uniformly (Fig. 3e)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Beverley
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during bradyzoite
  • Other genes localised in this publication: (3R)-hydroxymyristoyl ACP dehydrase, putative, acyl carrier protein

Ferguson, D. J., Henriquez, F. L., Kirisits, M. J., Muench, S. P., Prigge, S. T., Rice, D. W., Roberts, C. W., McLeod, R. L.
Maternal inheritance and stage-specific variation of the apicoplast in Toxoplasma gondii during development in the intermediate and definitive host. (2005 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

during bradyzoite and not tachyzoite
  • "The presence of both tachyzoites and bradyzoites was confirmed by double labeling with antibodies to the stage-specific antigens SAG1 (tachyzoite specific) and BAG1 (bradyzoite specific) (Fig. 2a)"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during bradyzoite, not during tachyzoite
  • Comment: strain information ambiguous
  • Other genes localised in this publication: enoyl-acyl carrier reductase, SRS29B (= SAG1, P30), enolase 2, nucleoside-triphosphatase I

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

during not merozoite and not sporozoite and not tachyzoite, cytoplasm during bradyzoite

Ferguson, D. J., Parmley, S. F., Tomavo, S.
Evidence for nuclear localisation of two stage-specific isoenzymes of enolase in Toxoplasma gondii correlates with active parasite replication. (2002 Oct, Int J Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane and not cytoplasm and not nucleus during bradyzoite, during not enteric and not tachyzoite
  • "Table 1."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RRA, NTE, M3
  • Gene model mapping comments: Blast from X82213, annotation matches
  • Localisation record: surface and not nucleus and not cytoplasm during bradyzoite, not during tachyzoite and enteric stages
  • Other genes localised in this publication: enolase 1, enolase 2, lactate dehydrogenase, lactate dehydrogenase, SRS29B (= SAG1, P30)

Lekutis, C., Ferguson, D. J., Boothroyd, J. C.
Toxoplasma gondii: identification of a developmentally regulated family of genes related to SAG2. (2000 Oct, Exp Parasitol) PubMed / full text
   more detail about this publication

during bradyzoite and not tachyzoite
  • "The stage speci-ficity was confirmed in the double-labeled sections where the SAG2D-positive parasites were also positive with anti-BAG1 (bradyzoite specific) (Fig. 4a), but negative with anti-SAG1 (tachyzoite specific) (Fig. 4b)."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during bradyzoite, not during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10315

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_059020 bradyzoite antigen, putative
MAPSASHPPGACPPGCTKHPATATAISPSGVCPMRAFHPAGPHSHFSCYDDLRNRLSHDKNVRPVASQQLDYLDEVSPFA
LAYYPPPFWGGVGLNPIDDMLFETALTANEMMEDITWRPRVDVEFDSKKKEMIILADLPGLQKDDVTIEVDNGAIVIKGE
KTSKEAEKVDDGKTKNILTERVSGYFARRFQLPSNYKPDGISAAMDNGVLRVTIKVEDSGGAKQQISVK

Gene-Specific Links for TGME49_059020

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins