ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_058770 ()

UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T2, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_37619

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • TGME49_058770 UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T2
  • NCLIV_027740 UDP-N-acetyl-D-galactosamine:polypeptide N- acetylgalactosaminyltransferase T2, putative
  • cgd6_1960 membrane-associated protein with a family 1 glycosyltransferase domain and a ricin domain with 3 transmembraned domains near C-terminus
  • cgd7_1310 extracellular protein with a signal peptide followed by a family 2 glycosyltransferase and ricin domains
  • Chro.60231 glycosyl transferase
  • Chro.70157 hypothetical protein
  • CMU_007930 glycosyl transferase, group 2 family protein
  • CMU_033300 glycosyl transferase, group 2 family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_058770 UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T2
MPVECPVGGGQETPRASWRRGEPGKKPLNSKLVARLRRRCLLLLGSLCVSVGIFWCLFSSGVLTLLFPGAFSRDSPQTHS
LDLHAPAVAELHSLLKGLPLPTHHEKATVDNSAIVVGVHGTVKAPYSRVVDHLLKIVVLPVLTGEPRYVTGDDFSVIIPV
RNEEAYLPKTLTFLFEVTPIERIREVIVVDDHSDKPIKAILEKTLPQHILDKTRIIRFDSPQGLIRGRVAGAAIATSDNF
FFLDGHCRPKVGWAEPLLAHLKTNYRRIACPKIYDIYLDSWEDVGTHGTKMMFEWTFEFGWFEDLEDEVPVLAGGILAMT
KKWWIESGLYDEGMLEWGGENLEQSIRSWLCGGEIVAVQESKIGHIFSRPPKPNPGNRLVIQVQKNQKRGAKVWLDEYYF
LFYKYHREVRGHQEGDITQRKKLRYEQLTCMPFQWYVEKFKTAFDRKGLLDHNFFHIEHEQTGLCLSSAYTPGFPDHRLV
LEPCDLHARLQQWTVAAGNRLIENREKKCIDAFVQQADARAPVVWTCDWNRVLQRQNENQFWQWDASLPGQAASANATGR
IFSFSHPDTVSLTGHDTLSVYRHLAASHHARCLVVEAPRSRGDEQKKLLFVNWKSCDEPVRPETNDGWTVENRGEGQDEE
EEVRGDRMRFKPKWFFAPLSSRVGLRTMEDANSITDQAAEKYLRKAPKPLDE

Gene-Specific Links for TGME49_058770

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins