ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_058410 (PhIL1)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
cytoskeleton and not conoid during tachyzoite
apical cap of inner membrane complex during intracellular tachyzoite

Who localised this protein by microscopy?

Anderson-White, B. R., Ivey, F. D., Cheng, K., Szatanek, T., Lorestani, A., Beckers, C. J., Ferguson, D. J., Sahoo, N., Gubbels, M. J.
A family of intermediate filament-like proteins is sequentially assembled into the cytoskeleton of Toxoplasma gondii. (2011 Jan, Cell Microbiol) PubMed / full text
   more detail about this publication

apical cap of inner membrane complex during intracellular tachyzoite

Gilk, S. D., Raviv, Y., Hu, K., Murray, J. M., Beckers, C. J., Ward, G. E.
Identification of PhIL1, a novel cytoskeletal protein of the Toxoplasma gondii pellicle, through photosensitized labeling with 5-[125I]iodonaphthalene-1-azide. (2006 Oct, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytoskeleton and not conoid during tachyzoite
  • "PhIL1 is conserved in apicomplexan parasites and localizes to the parasite periphery, concentrated at the apical end just basal to the conoid. Detergent extraction and immunolocalization data suggest that PhIL1 associates with the parasite cytoskeleton. PhIL1 peptides were detected more often in the "conoid-depleted" than the "conoid-enriched" fraction, consistent with our immunolocalization data and the hypothesis that PhIL1 is a cytoskeletal, nonconoid protein."
  • Microscopy type: Light, EM
  • Microscopy method: C terminal GFP tag, YFP tag, polyclonal antiody directly to protein
  • Strain: RH(EP)
  • Gene model mapping comments: Blast from DQ186991
  • Localisation record: cytoskeleton and not conoid during tachyzoite
  • Comment: particularly concentrated at apical end
  • Comment: YFP-PhIL1cterm targets as normal
  • Other genes localised in this publication: membrane skeletal protein IMC1, Rhoptry kinase family protein ROP4 / ROP7 (incomplete catalytic triad) ***WARNING: GENE MODEL INACCURATE ***, SRS29B (= SAG1, P30)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_30698

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_058410 hypothetical protein
MSQPNLQYAHTGAIEDYYRLHENSASDRHPLAQEYFSERIQRELNAPVIVHDRERPQQPPHTYIAGTPGPLHYGVPLSDG
CDPGVYAVSNALFDASGAFRSIPLKQGPVFRRRQRGDCQSEWSNAFVSRVDPCECGYPEETYTPYEVARYRDQYGHPHTT
LDFSR

Gene-Specific Links for TGME49_058410

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins