ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_057680 (MLC1)

myosin light chain TgMLC1, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex and periphery of parasite during intracellular tachyzoite
multi-lamellar vesicle and parasite plasma membrane and peripheral

Who localised this protein by microscopy?

Frenal, K., Polonais, V., Marq, J. B., Stratmann, R., Limenitakis, J., Soldati-Favre, D.
Functional dissection of the apicomplexan glideosome molecular architecture. (2010 Oct 21, Cell Host Microbe) PubMed / full text
   more detail about this publication

inner membrane complex

Heaslip, A. T., Leung, J. M., Carey, K. L., Catti, F., Warshaw, D. M., Westwood, N. J., Ballif, B. A., Ward, G. E.
A small-molecule inhibitor of T. gondii motility induces the posttranslational modification of myosin light chain-1 and inhibits myosin motor activity. (2010 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

peripheral
  • "(C) Dual label immunofluorescence of intracellular parasites expressing TgMLC11–79YFP, using antibodies against TgIMC1 and GFP. TgMLC11–79YFP largely colocalizes with TgIMC1, indicating that the first 79 amino acids of TgMLC1 are sufficient for peripheral localization."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: peripheral
  • Comment: strain information not found
  • Other genes localised in this publication: membrane skeletal protein IMC1

Pino, P., Foth, B. J., Kwok, L. Y., Sheiner, L., Schepers, R., Soldati, T., Soldati-Favre, D.
Dual targeting of antioxidant and metabolic enzymes to the mitochondrion and the apicoplast of Toxoplasma gondii. (2007 Aug 31, PLoS Pathog) PubMed / full text
   more detail about this publication

periphery of parasite during intracellular tachyzoite

Gaskins, E., Gilk, S., DeVore, N., Mann, T., Ward, G., Beckers, C.
Identification of the membrane receptor of a class XIV myosin in Toxoplasma gondii. (2004 May 10, J Cell Biol) PubMed / full text
   more detail about this publication

inner membrane complex

Ding, M., Kwok, L. Y., Schluter, D., Clayton, C., Soldati, D.
The antioxidant systems in Toxoplasma gondii and the role of cytosolic catalase in defence against oxidative injury. (2004 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

inner membrane complex during intracellular tachyzoite

Herm-Gotz, A., Weiss, S., Stratmann, R., Fujita-Becker, S., Ruff, C., Meyhofer, E., Soldati, T., Manstein, D. J., Geeves, M. A., Soldati, D.
Toxoplasma gondii myosin A and its light chain: a fast, single-headed, plus-end-directed motor. (2002 May 1, EMBO J) PubMed / full text
   more detail about this publication

multi-lamellar vesicle and parasite plasma membrane
  • "As anticipated for a TgMyoA-associated protein, TgMLC1 localized at the parasite plasma membrane under static conditions (intracellular parasites) (Figure 2C). In addition, during host cell penetration, TgMLC1 was slightly concentrated at the moving junction and in the part of the parasite penetrating the host cell (Figure 2A). Less than 10 min later, TgMLC1 was still distributed at the parasite periphery but also revealed a circle at the posterior end, delineating an open 'appendage' at the parasite posterior extremity (Figure 2B). This structure, visible only shortly after invasion, is likely to correspond to the transient posterior invagination where multi-lamellar vesicles are released to form the intravacuolar network (Sibley et al 1995)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from AY048862, annotation matches
  • Localisation record: surface and multi-lamellar vesicles
  • Comment: couldn't find strain information for microscopy
  • Other genes localised in this publication: SRS29B (= SAG1, P30)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23366

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_057680 myosin light chain TgMLC1
MSKVEKKCPVCYQKLPNPADVLGPMDKELNYFMWMPGFEWRPEPKVGEYDGACESPSCREGGRPAADEDMQEALEEMVEA
DEMYARFNARASGGKVSTGDAMILARQLGLAPSYADKQAFEEKSGDNLDYASFQKFVGTSTHPEDNIEDLVEAFAYFDVS
KHGYLTRKQMGNILMTYGEPLTTEEFNALAAEYFTSDQIDYRQFCKAMLERRE

Gene-Specific Links for TGME49_057680

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins