ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_057350 ()

eukaryotic translation intiation factor, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21922

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL13P1.63 (eIF4G) eukaryotic translation initation factor 4 gamma, putative
  • PBANKA_141130 conserved Plasmodium protein, unknown function
  • PY07184 synthetic antigen of P.falciparum
  • PVX_122470 hypothetical protein, conserved
  • PCHAS_141320 conserved Plasmodium protein, unknown function
  • PKH_141200 asparagine-rich protein, putative
  • TGME49_057350 eukaryotic translation intiation factor, putative
  • NCLIV_029720 eukaryotic translation intiation factor, putative
  • cgd2_3920 eIF4G eukaryotic initiation factor 4, Nic domain containing protein
  • Chro.20419 asparagine-rich protein
  • CMU_003040 MIF4G domain-containing protein
  • TA03690 eukaryotic initiation factor, putative
  • BBOV_IV007400 MIF4G domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_057350 eukaryotic translation intiation factor, putative
MMSHQPPTQTYSAGERGPQHGSGASRGSHSRDLDWDSLGGKRRVTGAPPGNACASAVPLSPAPEVAREEPAPSPPIMYHH
VASQGVGTNGGVYAPVYANTYYAPGAGLVGGAYPGYPQGSAPNYQQNKFYNSVKNGAFGPSAGSGGGGGGGGGGAGLVGH
APPPPGGGPGASAASPQHHAERKNFQRRNEGRHEGRSRGRDNANAVFFPPPVDGNCARQGGRRQEGGAFRAGGSRNGARR
ERGERSREQGGTNGSSGDEGGREENGNGGCSPLEARVVSAPEEERDGRLQAADTPVAAEKREEKREERREERREEKKEEK
REEMRTRSARVEPKKERDDGWDDDGFGGGVSMVDINEIRTKHAQLASKTPPLATATQGGAHSRAASAASLPALEPSLSQP
FGKKEEKKEEKKEEKKEEKKEEKKEEKREEKREDRAQFAGLPAMPQSMSPQSQEGDAAKKEEKKEEEKKEGSGVSTLKVG
GGAWRPRSQRQFTREEELDRTVKALLNKLTIEKFDTITEKLARTVEGLKEHKELQLVVNVVMEKAVTEPDWSEMYADLCQ
VLQWRSVPTEGTDIENFRKTPFMKALLTKIQAEYEAMPRSLESRLRSLPSGELDPEAIEEMQQLKRTKNRILGVVKLIGE
LFQRKILGFPIVRDVVVDLVIKNEEPDEHFIECFVQLIATTGYYIDQNPKVKAVLDSWFGRLTELQKKPCYSKRLKCIIQ
DTLDMRKAEWRKKIHKERAKALSDLREQLETEEVLGGSVHAAQYGNIVVVGQRSNLNGAYAGYLKEQQETFDRKVAKLRP
PAGAPPVGPGASSGANPVRR

Gene-Specific Links for TGME49_057350

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins