ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_056980 ()

glycerol-3-phosphate acyltransferase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13757

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_142850 glycerol-3-phosphate acyltransferase, putative
  • PY06015 glycerol-3-phosphate acyltransferase
  • PVX_123330 glycerol-3-phosphate acyltransferase, putative
  • PCHAS_143030 glycerol-3-phosphate acyltransferase, putative
  • PKH_142980 glycerol-3-phosphate acyltransferase, putative
  • TGME49_056980 glycerol-3-phosphate acyltransferase, putative
  • NCLIV_029980 glycerol-3-phosphate acyltransferase, putative
  • cgd6_1270 SCT1/Gpt2p-like glycerol-3-phosphate acyltransferase signal peptide plus 3 transmembrane domain
  • Chro.60161 glycerol-3-phosphate acyltransferase
  • CMU_008720 glycerol-3-phosphate acyltransferase protein, putative
  • TP01_0222 glycerol-3-phosphate o-acyltransferase, putative
  • TA19480 glycerol-3-phosphate acyltransferase, putative
  • BBOV_IV005200 glycerol-3-phosphate-acyltransferase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_056980 glycerol-3-phosphate acyltransferase, putative
MYFLVRWLCIGIVRSFFKEVAVLHPERIPLYGPAIFVGNHNNQFMDASMLVANIPRQVHFLVALKSMKRRVIGFLSRLAG
CIPVDRQDDRAFKGPGLVRISHHFTEDDHVCPRPPHHHHHARSHAADPGHSNGSESREKHDGGGGRPPETATEERQTPHA
DTGALHTPSGAVQAGSILLSGEAEAARRSAFEGTAGRTSEARMETKNEDDPREPQTREDGPSAESAAIPEAQTPELRAHT
RGESPAKLLAGEMLQAFSRVPSHPSLRTEMPLFSKSASAPLGMQNPPVLSILGNSTRFLSDVRPGYKLRLDGKDFLVLRV
LSDTHVVVRQPPEAPRRLDSSPLPTAAAPGGRTPETAGAVCELDRKAAERRGDAVARQANAQLAKEKESEREAEMGRRRG
SFSSESSSSSTGSRSQRGSSRRTNVGETAANAAAAAEAFATREDVPGLSQNGSSTALDANGRERETALLKAVPGNRGVDE
GRLREQAFAEMRRPVSPDPSAFGASRDEGLRRRRARRREEDREEKWRETHDGPGPGDSRGENDAGGLPGKMCDGREEGED
RLHQALSAKHEKEKRLAAAAYKEYKILPKIEQREVYEAVTHSLVDGDCIGIFPEGGSHDRTTLLPLKPGVAIMAIGGAAA
GADVMIVPVGLVYHNPHKTQSRATIHIGEPIPISREAVVEYQQDRRAATARILTDVEHGMRSCIITAQDHETMTLIHLCC
SLYPPERLRLSPEKLFNLNQLLSKLFWRCADSPELSNLRQDLAQYQGALQRAGIPDHDVWMLKQSTAGASLCFAEKLIAL
LFAIGLGVPLLPLWGPLRVIAYFLAERHRAQALAASSVKVKGMDVVASYKVIVLLVCVPLFNLVYGAIFGLVFRRTLAET
LATMLLCICLLPVAYYFSMRQAEKILPLIRQMRTLIIVVVGKVNIWRENERELITQRMNLQFSVRETLLKLGPQTSPAFM
EELYSILPKAVLVADIKRLIRKKEDFAPLQMKSLMNNAEEIL

Gene-Specific Links for TGME49_056980

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins