ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_056970 ()

vacuolar ATP synthase catalytic subunit A, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10722

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_141040 vacuolar ATP synthase subunit a, putative
  • PY01556 V-type ATPase, A subunit
  • PVX_122430 vacuolar ATP synthase catalytic subunit A, putative
  • PCHAS_141230 vacuolar ATP synthase subunit a, putative
  • PKH_141110 vacuolar ATP synthase catalytic subunit A, putative
  • TGME49_056970 vacuolar ATP synthase catalytic subunit A, putative
  • NCLIV_029990 vacuolar ATP synthase catalytic subunit A, putative
  • cgd7_5000 vacuolar ATP synthase subunit A
  • Chro.70559 vacuolar ATP synthase catalytic subunit a
  • CMU_019130 vacuolar ATP synthase catalytic subunit A, putative
  • TA10370 vacuolar H+-ATPase, a subunit, putative
  • BBOV_III008150 vacuolar ATP synthase catalytic subunit A
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_056970 vacuolar ATP synthase catalytic subunit A, putative
MAPRGEAAAPEGDAEMGIIYKVSGPLVLAEQMSGTKMYELVRVGWQRLVGEIIRLEGDKAFIQVYEETAGLCVGDPVLKT
GKPLSVELGPGLLDNIFDGIQRPLERIAQVAQSVFVPKGVDVPALDHKKLWEYNPVANVQVGDILTGGDIIGTVHENNLF
LEHRIMIPPKIQGKVSWIAPAGSYTVKDTIMTLEYRGEQIPIQMAHDWPVREPRPCLEKLSGNTPLLTGQRVLDSLFPTV
QGGTCAIPGAFGCGKTCISQALSKYSNSQVIIYVGCGERGNEMAEVLTEFPELTTVVNGQEEGIMQRTCLVANTSNMPVA
AREASIYTGITLGEYFRDMGYHVAMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERASRVRCVGSPERE
GSVTIVGAVSPPGGDFSDPVTTSTMSIVQVFWGLDKKLAQRKHFPSVNWTTSFSKYIRALEPFFDSYDAEFSSLRQKISD
ILQQEAELTDIVQLVGKDSLSEDQKLILEVARIIREDFLQQNAFSDYDYMCPLYKTVGMMRTICHFYDQCLRVMQETSGS
EHKIGWGTIYNTMRPTISRITSMKFLPPTTTEAQAKQHFKQLSDEITSGLRGLVEK

Gene-Specific Links for TGME49_056970

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins