ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_056770 ()

ATP-dependent helicase, putaive, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11419

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFD1070w eukaryotic initiation factor, putative
  • PBANKA_052310 eukaryotic initiation factor, putative
  • PY06447 eukaryotic initiation factor 4a-3
  • PVX_090175 eukaryotic initiation factor, putative
  • PCHAS_052330 eukaryotic initiation factor, putative
  • PKH_052620 eukaryotic initiation factor, putative
  • TGME49_056770 ATP-dependent helicase, putaive
  • NCLIV_015210 ATP-dependent helicase, putaive, putative
  • cgd7_3940 eIF4A-1; eukaryotic translation initiation factor 4A-1; RNA SFII helicase
  • Chro.70440 eukaryotic initiation factor 4A-3 (eIF4A-3) (eIF-4A-3)
  • CMU_014040 DEAD/DEAH box helicase family protein
  • TP01_0765 eukaryotic translation initiation factor 4A, putative
  • TA06920 eukaryotic translation initiation factor, putative
  • BBOV_IV010990 eukaryotic initiation factor 4A-3 (eIF4A-3) , putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_056770 ATP-dependent helicase, putaive
MARLEPDTNFIFETSEDCQVLPTFDAMGFKEDLLRGIYAYGFERPSAVQQRAIVPIMKGRDVIVQSQSGTGKTCVFCLGC
LQCIDPKVRDPQALILSPTRELAEQSQKVCLALGDYMSVQVHCCIGGKRVGDDIRALEAGVHIVSGTPGRVFHMIAQRHF
STRHIKLLVLDEADEMLNRGFKEQVYDIYRYLPPSTQVVLVSATLPHEVLEMTTKFMDDPFRVLVKRDELTLEGIKQFFV
AVEREQWKFDTLTDLYDTLTITQAVIFCNTKAKVEWLAQKMKEANFTVSRMHGDMPQQERDEIMRQFRGGQSRVLIATDV
WGRGLDVQQVSLVINYDLPNSRELYIHRIGRSGRFGRKGVAINFVKNDDIRILRDIEQYYATQIDEMPMNVADLI

Gene-Specific Links for TGME49_056770

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins