ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_056000 (ERD2)

endoplasmic reticulum retention receptor, putative, a gene from Toxoplasma gondii

Compiled localisation
apical end of the nuclear envelope during tachyzoite

Who localised this protein by microscopy?

Pfluger, S. L., Goodson, H. V., Moran, J. M., Ruggiero, C. J., Ye, X., Emmons, K. M., Hager, K. M.
Receptor for retrograde transport in the apicomplexan parasite Toxoplasma gondii. (2005 Feb, Eukaryot Cell) PubMed / full text
   more detail about this publication

apical end of the nuclear envelope during tachyzoite
  • "TgERD2 localizes in a Golgi or ER pattern suggestive of the HDEL retrieval reporter"
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain:
  • Gene model mapping comments: blast from AY095348, annotation matches
  • Localisation record: apical end of the nuclear envelope during tachyzoite
  • Comment: No recorded parasite strain
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10752

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_113020 ER lumen protein retaining receptor, putative
  • PY05552 er lumen protein retaining receptor-related
  • PVX_114670 ER lumen protein retaining receptor, putative
  • PCHAS_112970 ER lumen protein retaining receptor, putative
  • PKH_111750 ER lumen protein retaining receptor, putative
  • TGME49_076910 endoplasmic reticulum retention receptor, putative
  • NCLIV_029080 hypothetical protein
  • NCLIV_068650 endoplasmic reticulum retention receptor, putative
  • cgd8_1110 ER/lumen protein retaining receptor (KDEL receptor), signal peptide plus 4 or more transmembrane domains
  • Chro.80131 endoplasmic reticulum retention receptor
  • CMU_025020 ER lumen protein retaining receptor protein, putative
  • TA11365 endoplasmic reticulum lumen protein retaining receptor (ERD2 homologue), putative
  • BBOV_III009160 ER lumen protein retaining receptor
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_056000 endoplasmic reticulum retention receptor, putative
MAMNAFRFAGDMLHLLSIVLLLLKLRRSKNCVGISCRMQEMYLLVFCSRYVDLLYHFISVYNTAMKLFFIASTAYTVYLI
RFKPPISQTYDRRADSFPYEKYLIPPCILLSLVTAEDWSVSEILWAFSIWLECVAILPQLILLQQLREVENLTGNYVAAL
GAYRFLYILNWVYRYFAESPPYVNYVGWIAGVIQTALYVDFFYYYALSKWYGQKLVLPVHAEV

Gene-Specific Links for TGME49_056000

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins