ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_055890 ()

monodehydroascorbate reductase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10212

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF07_0085 ferrodoxin reductase-like protein
  • PBANKA_061790 ferrodoxin reductase-like protein, putative
  • PY01431 Tamegoloh, putative
  • PVX_096305 ferrodoxin reductase, putative
  • PCHAS_061960 ferrodoxin reductase-like protein, putative
  • PKH_031420 ferrodoxin reductase-like protein
  • TGME49_007620 pyridine nucleotide-disulphide oxidoreductase domain-containing protein
  • TGME49_055890 monodehydroascorbate reductase, putative
  • NCLIV_002590 Phthalate dioxygenase reductase subunit, related
  • NCLIV_029160 Pyridine nucleotide-disulphide oxidoreductase family protein, related
  • TA17660 ferrodoxin reductase-like protein, putative
  • BBOV_III001680 pyridine nucleotide-disulphide oxidoreductase domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_055890 monodehydroascorbate reductase, putative
MVSLSGTLNGEEALERQLLPPEGDSVQVQYLVVGGGVAAGYFFHYFAEPLPLQSGEKSGTTISGEDMAGGFYKNALGNVS
PEASCSMGAPGDPESQNIGSLSLDKTTEGTCDRAKMEVGESEAKSHTWGAERPPTEPTGPGRKTKKGGTNMPGAHKETAV
RVAPYPPASHRTLSSRARSLPKLTQQEQGRKIRFLMVSAEGVLPYERPALSKGFLLGKTSFPNFNVAAGISGAIQDAQWY
IDRGIRVLLNETVSSVDLANRAASLQNSQRTVYFDTLIVATGLRPVDFADLGMWSLRGVPSNIFTFRFAKEAIHTVDLVK
QIKERSSAILNKALPDSDQSLGTADASKGSAVVIGSGFTGTEVAAALCQLGLKVILVTRSTRLLSKIFSPELSEFYEKQF
EQRRVTIIKNASVQNLVRDVDNDNRVSAVHVTLSDGTSHVLQADFVVAAVGSRPVVDFLNWQLMLADECVGGGILVDQNL
QAFPSRDVQIAAASAQKPHPEVFALGDVAAFPQTRNGGRPVRYEHVWNARSMAQFLAKHLRFLEQREEREKKTAGEACDL
LQEAEQEESESAAALEAAEDGDPPRTDTPQKDSDSNESDAENHERDGGYQFLPIYYSRIFDFSWKFFGFSKGTPVLVNDF
DRQISRKIVALWIEADHTVQGAFLEGGAPDEEELLRRAADAAIVVSPEAIQKAKDVAEVLKLIRLGVEQPLTRRSEPA

Gene-Specific Links for TGME49_055890

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins