ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_055370 (Tic20)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
innermost apicoplast membrane during tachyzoite

Who localised this protein by microscopy?

van Dooren, G. G., Tomova, C., Agrawal, S., Humbel, B. M., Striepen, B.
Toxoplasma gondii Tic20 is essential for apicoplast protein import. (2008 Sep 9, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

innermost apicoplast membrane during tachyzoite
  • "We demonstrate that Tic20 of Toxoplasma gondii is an integral protein of the innermost plastid membrane."
  • Microscopy type: Light, EM
  • Microscopy method: HA tag
  • Strain:
  • Gene model mapping comments: blast from EU427503 incomplete, TGME49_055370 in 5.0 beta looks to have better coverage, but blast on beta toxodb has problems
  • Localisation record: Innermost apicoplast membrane during tachyzoite
  • Comment: No recorded parasite strain
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_30472

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_055370 hypothetical protein
MTRSAVPHAFQFPGGFMCGPFLEQRDYLKHSCLSALRRGSPLDQGQRMPYTLSTVSGFKGCDVRVPPIGPLCPHHSSLHM
DTRSPVRGPRASRLFASRATDAQNTPATASRRSTGFLVRVPSFVHRLAAAAMYFVPNLELLQTFLPFLTTMLPSAAPLWT
IAARCLELYSRIPCASLLSFGAPYTLLIKKKELFKPSYFLRHHTMTALLLSMLQYTLSMIYLKGVSASVTGTAHETIVLS
LFITAQTLLLSSMFSALSAKYAWVPVVTEAVTMHIGEKPSDSY

Gene-Specific Links for TGME49_055370

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins