ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_055260 (AMA1) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

apical membrane antigen 1, putative, a gene from Toxoplasma gondii

Compiled localisation
moving junction during tachyzoite invasion
microneme during extracellular tachyzoite and tachyzoite
not rhoptry during tachyzoite
apical during extracellular tachyzoite

Who localised this protein by microscopy?

Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B.
Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

microneme during tachyzoite

Harper, J. M., Huynh, M. H., Coppens, I., Parussini, F., Moreno, S., Carruthers, V. B.
A cleavable propeptide influences Toxoplasma infection by facilitating the trafficking and secretion of the TgMIC2-M2AP invasion complex. (2006 Oct, Mol Biol Cell) PubMed / full text
   more detail about this publication

microneme

Zhou, X. W., Kafsack, B. F., Cole, R. N., Beckett, P., Shen, R. F., Carruthers, V. B.
The opportunistic pathogen Toxoplasma gondii deploys a diverse legion of invasion and survival proteins. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

microneme during extracellular tachyzoite

Donahue, C. G., Carruthers, V. B., Gilk, S. D., Ward, G. E.
The Toxoplasma homolog of Plasmodium apical membrane antigen-1 (AMA-1) is a microneme protein secreted in response to elevated intracellular calcium levels. (2000 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme and not rhoptry during tachyzoite
  • "In contrast to full length Plasmodium AMA-1, which has previously been localized to the rhoptries, it is shown here by immunofluorescence and immunoelectron microscopy that intracellular TgAMA-1 is found in the micronemes."
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein, polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AF010264, annotation matches, gene model inconsistent
  • Localisation record: microneme and not rhoptry during tachyzoite
  • Other genes localised in this publication: dense granule protein GRA8, microneme protein 2, rhoptry protein, putative

Hehl, A. B., Lekutis, C., Grigg, M. E., Bradley, P. J., Dubremetz, J. F., Ortega-Barria, E., Boothroyd, J. C.
Toxoplasma gondii homologue of plasmodium apical membrane antigen 1 is involved in invasion of host cells. (2000 Dec, Infect Immun) PubMed / full text
   more detail about this publication

moving junction during tachyzoite invasion, microneme and not rhoptry during tachyzoite, apical during extracellular tachyzoite
  • "TgAMA1 is found distributed predominantly on the apical end of the parasite surface.... Thus, biochemical analyses confirm that AMA1 is a microneme, not a rhoptry protein, in T. gondii. "
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: Blast from AAB65410, annotation matches
  • Localisation record: Moving junction ring during tachyzoite invasion, microneme and not rhoptry during tachyzoite, apical end during released mature tachyzoite
  • Comment: couldn't find strain information for microscopy
  • Comment: essential? Cannot be disrupted
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114967

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_055260 apical membrane antigen 1, putative
MICSIMGGLRSLRAARPYSHQSNTETKHMGLVGVASLLVLVADCTIFASGLSSSTRSRESQTLSASTSGNPFQANVEMKT
FMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFN
LNFVTPSGQRISPFPMELLEKNSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILYVSMQLMEGKK
YCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVES
KAQCWVKTFENDGVASDQPHTYPLTSQASWNDWWPLHQSDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAA
VSYTAAGSLSEETPNFIIPSNPSVTPPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNECG
SNTALIAGLAVGGVLLLALLGGGCYFAKRLDRNKGVQAAHHEHEFQSDRGARKKRPSDLMQEAEPSFWDEAEENIEQDGE
THVMVEGDY

Gene-Specific Links for TGME49_055260

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins