ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_054900 ()

proteasome subunit beta type 2, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11197

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0676 20S proteasome beta 4 subunit, putative
  • PBANKA_133410 20S proteasome beta 4 subunit, putative
  • PY06665 proteasome subunit beta type 2
  • PVX_116925 20S proteasome beta 4 subunit, putative
  • PCHAS_133870 20S proteasome beta 4 subunit, putative
  • PKH_123440 20S proteasome beta 4 subunit, putative
  • TGME49_054900 proteasome subunit beta type 2, putative
  • NCLIV_009170 Proteasome (Prosome, macropain) subunit, beta type, 1, related
  • cgd1_420 20S proteasome beta subunit D2 (PBD2) , putative
  • Chro.10054 20S proteasome beta subunit D2 (PBD2)
  • CMU_035100 proteasome subunit beta type 2, putative
  • TP01_0187 proteasome subunit beta type 2, putative
  • TA19315 proteasome subunit beta type 2, putative
  • BBOV_I004450 proteasome beta 2 subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_054900 proteasome subunit beta type 2, putative
METVIGIRGRDFALVACDRYANSSILRMKDDEDKLLLVDDDKVMGFAGQIGDRLQFGDYIQKNIHLYRFRNNKKLGCAAA
ANFTRQQLAYYLRRSPYHVDVMLAGYDEMGPHLYWMDYLASMVSVNKAAHGYAAYFLGGLLDRYYHPELTEEEALKIIEM
CKKELMTRFIVSQASFRVKVATKEGIRTLDI

Gene-Specific Links for TGME49_054900

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins