ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_054720 (GRA8)

dense granule protein GRA8, a gene from Toxoplasma gondii

Compiled localisation
dense granule and parasitophorous vacuole during tachyzoite
periphery of parasitophorous vacuole during shortly after invasion of tachyzoite
not oocyst wall and not parasitophorous vacuole during bradyzoite
during not merozoite

Who localised this protein by microscopy?

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during tachyzoite, not oocyst wall and not parasitophorous vacuole during bradyzoite, during not merozoite

Carey, K. L., Donahue, C. G., Ward, G. E.
Identification and molecular characterization of GRA8, a novel, proline-rich, dense granule protein of Toxoplasma gondii. (2000 Jan 5, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

dense granule during tachyzoite, periphery of parasitophorous vacuole during shortly after invasion of tachyzoite
  • "We have generated two monoclonal antibodies (MAbs 17.9 and A3.2) against Toxoplasma gondii, both of which localize to the dense granules of tachyzoites by immunoelectron microscopy. MAb 17.9 is directed against GRA6, a previously described 32 kDa dense granule protein. MAb A3.2 is directed against a novel 38 kDa dense granule protein, which we refer to as GRA8. GRA8 is released into the parasitophorous vacuole during or shortly after invasion and associates with the periphery of the vacuole."
  • Microscopy type: Light and EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: blast from AF150729, annotation matches
  • Localisation record: dense granule during tachyzoite, periphery of PV during shortly after invasion of tachyzoite
  • Other genes localised in this publication: granule antigen protein GRA6

Donahue, C. G., Carruthers, V. B., Gilk, S. D., Ward, G. E.
The Toxoplasma homolog of Plasmodium apical membrane antigen-1 (AMA-1) is a microneme protein secreted in response to elevated intracellular calcium levels. (2000 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

dense granule
  • "To localize TgAMA-1 in T. gondii, dual label immunofluorescence microscopy was performed on free tachyzoites using MAb B3.90 and antibodies against known microneme (MIC2), rhoptry (ROP1), or dense granule (GRA8) antigens."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule
  • Other genes localised in this publication: apical membrane antigen 1, putative, microneme protein 2, rhoptry protein, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114328

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_054720 dense granule protein GRA8
MALPLRVSATVFVVFAVFGVARAMNGPLSYHPSSYGASYPNPSNPLHGMPKPENPVRPPPPGFHPSVIPNPPYPLGTPAG
MPQPEVPPLQHPPPTGSPPAAAPQPPYPVGTPGMPQPEIPPVHRPPPPGFRPEVAPVPPYPVGTPTGMPQPEIPAVHHPF
PYVTTTTTAAPRVLVYKIPYGGAAPPRAPPVPPRMGPSDISTHVRGAIRRQPATATTTTTTRNVLLRTAILAAAAATLIA
LFRQRPLFTEGVRMFPDFQYRFTVQTTQN

Gene-Specific Links for TGME49_054720

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins