ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_054550 (GCN5) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

histone acetyltransferase GCN5, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and nucleus during tachyzoite

Who localised this protein by microscopy?

Bhatti, M. M., Sullivan, W. J. Jr
Histone acetylase GCN5 enters the nucleus via importin-alpha in protozoan parasite Toxoplasma gondii. (2005 Feb 18, J Biol Chem) PubMed / full text
   more detail about this publication

nucleus during tachyzoite
  • "The TgGCN5 NLS is sufficient to translocate a heterologous protein to the parasite nucleus. "
  • Microscopy type: Light
  • Microscopy method: FLAG tag
  • Strain: RHhxgprt-
  • Gene model mapping comments: blast using nuclear localisation signal, annotation matches, gene model inconsistent
  • Localisation record: nucleus during tachyzoite
  • Other genes localised in this publication: -

Hettmann, C., Soldati, D.
Cloning and analysis of a Toxoplasma gondii histone acetyltransferase: a novel chromatin remodelling factor in Apicomplexan parasites. (1999 Nov 15, Nucleic Acids Res) PubMed / full text
   more detail about this publication

cytoplasm during tachyzoite
  • "TgGCN5 as well as the point mutated Tggcn5F224A protein show the same distribution throughout the cytoplasm."
  • Microscopy type: Light
  • Microscopy method: myc tag
  • Strain: RH
  • Gene model mapping comments: Blast from AF155929, annotation matches, gene model inconsistent
  • Localisation record: cytoplasm during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

No entry found in OrthoMCL.

Amino Acid Sequence

>TGME49_054550 histone acetyltransferase GCN5
METVEVPAFLEAANSAEAPRPASPAREVDVQLTVPCPRDGADAGEAVGTRKRSRGPADRAEEASGRTHSAAEEPRAKEGG
LSPASRDGDSGQSRKRVKREWTSGGRLEQRGPLGVAAHAVEWRRASAEARGDARQTPDAARGSSCRVDRFVGEDGVLDEG
DLFSPSPFWPFFSACDPVALAPAPTVCPDTPSVSVVSACSRLLRAPPRDLASEATLDSLAGNVHVEESLWRGCESPNILE
ILRDILVVFAKDPSTQLSKMFHTASLLAPYQAASCHAASDAERDKKGDEADSARRRDHHEKERDHGGGPLAVGESADSEG
RHPGATEHAAGEAAGEAADGVRTADGDACQERRAEGAGAANGVAPLGMPEPAHAVGDRERENGSLEVKKAEREDAERLEN
GGGGQTAGEDREDVNDDPRDTEREPGPQQAGRRCLEANGVRGVKQEQENAGTDEERVLYLQLKEVVLSVAAALEIQQLEP
PRKRKDPKKKPHSSSASSACSRGRGNAGSSSVSGSLLRRTVLPRTERGAVETPRVPERTAK

Gene-Specific Links for TGME49_054550

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins