ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_054370 ()

adenylate and guanylate cyclase catalytic domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12580

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0395 guanylyl cyclase
  • PBANKA_091030 guanylyl cyclase, putative
  • PY04450 guanylyl cyclase-related
  • PY04451 guanylyl cyclase-related
  • PY04459 guanylyl cyclase-related
  • PVX_092535 Adenylate and Guanylate cyclase catalytic domain containing protein
  • PCHAS_071160 guanylyl cyclase, putative
  • PKH_093620 guanylyl cyclase, putative
  • TGME49_054370 adenylate and guanylate cyclase catalytic domain-containing protein
  • NCLIV_008660 adenylate and guanylate cyclase catalytic domain- containing protein, putative
  • cgd3_1110 P-type ATpase fused to two adenyl cyclase domains and 21 predicted transmembrane regions
  • Chro.30141 guanylyl cyclase-related
  • CMU_042790 adenylate and guanylate cyclase catalytic domain-containing protein
  • TP02_0848 guanylyl cyclase, putative
  • TA15475 guanylyl cyclase, putative
  • BBOV_I000770 adenylate and guanylate cyclase catalytic domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_054370 adenylate and guanylate cyclase catalytic domain-containing protein
MSAFKSRTTAAERSQRARKRPHDEHRGRGREHGGARDPGAGGQAMKGAEKGRNPKHQATQKQMSFLQGKHQQRVGNVVSR
LGPAAVGQTTLMDKKRKLYSDTSQQPLWSLRKITINPTDKDDLRRFPSNAIYTHRYSAMTFIFKNLWEQFHRVINWWFLV
MAIIQAIPQLHYNPNHAWSTALPFAIVLVFGMLKDAFTDLGRRERDRVLNQRVCCIVDGHTPQLRLLQWQGVRVGNILRL
TDGEEVPADIVVLATSNTDGVAYVETSKLDGETNLKFKQGVKETRGESSPLSIAGIRGRVVCEKPCAVMDAFTGSLKLDA
HPRATPLDIVNFIQRGSHIRNTEWLYGVVIYTGEDTRIQKNAAPPGFKRPHIEKDINTYLFISFFIVFLTILISVMSKWS
VQERDSGDTGVTDAGASSGSGSSSGETSQTYGSSVEFMLGSRDLLQNPWMSILRFLAVYAPVLPLSLPLILDVVYLLQSV
LIEGDIHIRGGGRTPATGRGNGSTSSMTVADDGLPDGEAGGLDSAHSSQNASLQQPLSIVSKGFSKTRRFLSEKFSSPSS
GQIGGGQDRRETPREDDERETNGENVPSATPLLPGGEAACVATGDEETLRADAEGAQERDREAEGNREQLKSVPTGTHAA
WRPGALDSTAEANEDEDPDVLHAEKASGFGARRSDDRDRKSSCSRYPETGGEKTSHAISGRFTGSVMPSTYTKLHGDIAN
AGFESAWQPYANGHTHTRTLLLATGGGPNSLCATGNFEREDVWAEVHTPALNPNLGQVDFIFTDKTGTITENDMTFSMCS
VAGKIYGMASCGGAGYEGAESSEYGSRAWTANETSARSSRDRLVPHLQRGTSAASSRSQSAPASANDEGTPRRIPTLMLR
PQTLTNQQTGQQSPVLPASREDEKGKDASPGAADSPASSLSVSRFFGSVSYEGRLEETGSQKEEDSRSDRVSLSPSEGRV
SGSRPQLACEGIHGATLRRRTVGIQSQHSSQSLLSSRQQSEDERQYTEGEEGETEDDRSTVSRRGRDRMYSRDYHRESRS
SSPRDGELSDRYPLRCIRSIGDGYIIRGGRTGNVVMRHPSGMSFDSRPSSQFTFSSPVVGDDSFDDSRRAMYFGRGSPRS
LTPPSERGTASPSVGEEGPPLSPQISPTGSARGRVPRSSSLYMPAVDEGEDRERYFRPRRRMLRPGASLLPPLSPSPSRA
GVPFLYDNIDFPTGFRETPMEGQIRRNCDFYDASIFTDLARKDLRSHRINEFIKCMALCNTVVPWVYTATPCSSSCPGLP
STANFSVAAYPTGGGANSLFSCSASAFAGPVTQGFPSVTHPAALASDGAAGADEDEEKNVSQLLLPSGTSASSGAPSGPR
GDPQLVSLLGRQGQGHGSLGAPGSGLPTSGCLGGAGGSGARGPMGLHGSRRSLPGSSDCRVPSTARPAPLLGPDAAGRGF
GPDYVPSPRPLSPAGPPNASTGSLGEAPKADKPASPEEAASPGKDGEEAPSSTPRCVFAPSTLVPPSVLRSHTGAGGLRP
SKSLARGVSFKEKHEEFAFSKDEDTATVDQDDTQSATDEEHDVEGEEEEAGKSAERLTKAKRNRSASASLMSLKSKVTAS
GRDVADLLFRRGSRGNSGTDPDPASARTVGRSSSVERAQQPPTHGGFSTVTGTGESRSSLVSIIKYQASSPDEECLVSAA
SHMGYTLVSRTNNYAILNINGQERRWQIIGVNEFTQKRGRMSIVVRPQEWTEGSILYVKGADVAMLDLLSTSFTRGHDFR
QSFSCLSRYAESFSGGRGPQVSLSRLQSNASTKGSGGPPVRRSVSGSDPRLQPSRSVSLPRTVPPGQETPMAGDQLEGPE
AAETVNPSGQTYSQGEEEEGLRSRLARADSMLRSLNPALYNYDKQHQRGHGPEGDEGSHELEGHDAHTGDSHGGHHRDQA
EPRAGDAVGPESASRLPQKTQNRLPQHLGNAGVCAHGHAWTPSEENYCAAFFDDDEDELIALGDIALVEQHLKRFSLQGL
RTMALACRYLTQEETETYKRLYTDACASVYCRAERLEEVAEDMERDLEYLGITGVRDKLQEQVPETLQLMMEAGIRVWMV
TGDNVEYALHICHSCRLLTSRTRIFHAALEFSGRKAKREGVMLYELFRKARRLKRSDEHICLVVTGPNLRTFLNHPDLQT
YFLNMACCSDVVVAARVTPSQKAEMVRLVKKRLTPQPITMAVGDGGNDVAMLQEAHVGVAIRGKDSAAAVAAAYADYSFT
EFRFLQRLLFVHGRLSLMRVSTVILWSFFKSLCIGLPTFLFQPQAFWSAVEVYDPLLLMIVDFFWTTLPGIIHGYSDQDL
PTHLLPSVPVLYTPGRRRLYFNGFRFILWTVEGIIYSFLIFYLLQATWMDGNTFHDGQVLGFHSYGILLLFGSLLQSNVR
IILETSLWTPTFLFTTIVLCTIMFFPTVLLYSVTGWPRRYMELAGRVVFAWPMLYFLIPLWVSIGILVQLLLQVFTSSLF
PNISGSVKQYLAQKQADVNYRRKASKHPFSQPRPRLLPGGHDEYGLFCGMGSCWSLFKRSLWFMGGCCLMDTPNVADDFT
ASPALCAELRERFNPLRRKSVADRLPPPRRFRINENFLSYTGASDEKGADGVQRDLGGKGSACGPGAAGLTAGTGAPGAG
RSKSVFGGGGGVMPMADMAADLETENSLSSNGSEQEKAGDNVTKLVKVSHLINRFTLRFKDMQLEADYQIHNKKSFLKRL
VPWYRVIFMLIALYQLLSFLTEYFIDIHWNPGETEMEPWMCVPTLVVEIGFAAVVVCTFYDFIFLDHFSLILNSIVFLMV
SSSIVFYTASHVDGTLTSVLFPVFTFVILRISFLQAVVWNILFLIVTVARFMLDKKYLPPLNFVHYIPLFIGIDVFVAFV
GYRLEYNQRKSFLLDYSVDASRRKQREILNTMLPSFVVDQMINSELNEEGIPTSLKAEDRGTVSVIFCDVYEFQHVVASI
EPTRLVEVLDSLFLCFDRSAEQFGCTKIETVFETYLAAAGLQPGREASPASYQQDACDALDMALAMLEVAAQIRYEVKSN
QGVLSGSAVGSSSAVGPAVSASNLEASGNHMEPRLSLHGHNSGVAMGSRMNSSRFHRQKTGSVVRTVLQSRPQRIRVKIG
IHSGRVISGVVGAKKPQYALFGDTVNTASRMKTTGQPGYIHISEDSYELVKGDDTLEYESRHTEVKGKGLMNTYLLVRVK
GSPYPHFDDQEADEGDVISETGGQNGESRRSTASLPRQLETAGASSGVHTGEAMGCFASVGSRGESQTAADAAAAEAIEE
DIQVEIDEEGVVEDTVEKAVEDVRRLRNEGSHAVASDDFPVSQAGAAQPRRCSRFLFQNAEEHGAAEPQRGEGARLILSP
GQTEGTRQSEKEGSALGSNIAASARADRRPAGRREDSRGDSRFDYESMTTQQLLRIYRRQQKVAKVLQWIDEELRGQRDT
AHRHARTADIVAKLLASSGDEQAAGESSEADHDEVPLDEIKEELRRQAREANEQEPAKRSGGDAPPHTPTRKALLKAFRS
EIVHGCAAPTEEEKTAKEGRESEVALASPETESRDANGQRVSERDASDAREGGASPQPDHAAPPSGLPQGLKGQETEKQQ
GWKLFRSASLVRAAGQSFASLFRRRKPAAPSEAASPSSADTPMDSRVSPTSVDDEDLEQNRVTRIGVSSEWLLLKFKDKN
LEARYRTHFYNNKSNINTIEQALIIFLVTFCVQTLTRLALPRFYVVCSHHTINLHVCTGLYWAVRATYTLAAFVLWMLFH
YRNRKEVATCLELRWMVFLLNLLFISASCVFALSNSWGVCGQQQEDHGASETAVENTLVALSHLAKDGSFPADDAEVNSV
AGSPLAQAMHSPFTTAGVSRASRMLRSGGVSVSGGTDCTGVGTSGEEGSDLVTANGRAYTYWLLSDTIELFFYIVILHHN
TGLLFQNCILVDVLLMTMSLTFIITTARETASTVSTIATFPCYVFFNLVSAYCKEYIDRLTFYVNEHAKTTESRATQLLN
DMLPKQVLEEFQQDKLKLAYLHENVTFLFADICGFTSWAKGVDACEVVTMLQKLFAKFDKDSTKFGLYKLCTIGDAYVAV
SEPVTAENQDTDPREGMWLVYEMAKAMIGNITEVRERLCIPNLNMRIGLHYGSCVGGVIGSGRLRYDLWGMDVLTGNMME
SNGVPGKINVSEILKNEMEKGFPGEFVFKFNKTVAVLQSTVDSYLIRPAKDFDEDEELAAAAATMAVAGPSASLQQGGGA
IPQVQAVASGLRRDATSIRGNYRRRFTILGSAPRVLGRRQSLRGHQFSALALVSHGDSGPSDEPRHLGDEGQAAGSVTSH
DGPLREEVEDDEIDGLKQLRKEIERAGGLGLDASPSDIGSTPGSALGS

Gene-Specific Links for TGME49_054370

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins