ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_053960 ()

short chain dehydrogenase domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10808

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • TGME49_053960 short chain dehydrogenase domain-containing protein
  • NCLIV_008280 short chain dehydrogenase domain-containing protein, putative
  • TP01_0657 3-oxoacyl-[acyl-carrier protein] reductase, putative
  • TA02925 short chain dehydrogenase, putative
  • BBOV_IV010140 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_053960 short chain dehydrogenase domain-containing protein
MESLARRLCVYTLTWLAILGDADDLLQASRYKRDGSFLVPPHIWHVETAACRWMIHQRPNVFRRLEADLRTESAFVGANH
SQSWGDALDACWSSSSFVSRALCLGIASFRGAAFALSAFNSWREREKAQERKLAVLVTGSSSGIGLQVTRLLLALDFYVI
GTRLHSEDPRRVFEEICRGNSRLLLLPMDVTNAEDVARAVEATKKFLRENDVSGLYALVNCAGIWNWNFIQTQSPQETEK
SLKSWRELFDVNLLGAVRVMHAFLPLMQARAVFVGSILGRMSSPGQTAYCASKAAVRLLAEGARSDARDAGVNVVLVAFL
AEVRVAPAQHVKSSTCVFAKETLTLCHPGRRRRTRGQLSPRHPRGCFYRPVQSSAGARLSARANRERNCRLHSLCSDAAH
CSLCWMGYVRMETA

Gene-Specific Links for TGME49_053960

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins