ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_053900 ()

delta-aminolevulinic acid dehydratase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10917

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_130410 delta-aminolevulinic acid dehydratase, putative
  • PY04302 porphobilinogen synthase, putative
  • PVX_118480 delta-aminolevulinic acid dehydratase precursor, putative
  • PCHAS_130730 delta-aminolevulinic acid dehydratase, putative
  • PKH_126610 delta-aminolevulinic acid dehydratase, putative
  • TGME49_053900 delta-aminolevulinic acid dehydratase, putative
  • NCLIV_008230 Delta-aminolevulinic acid dehydratase (EC 4.2.1.24), related
  • BBOV_II001120 delta-aminolevulinic acid dehydratase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_053900 delta-aminolevulinic acid dehydratase, putative
MRPLSLFFRLSFLLFVLLFPSPSVDALLQSSSVAGSFPTPASVASSGRSVSPHNALYVHSRTEATAGLPSGASLAITLNG
ESEEPRRNGARRKGSKSLGFLVAPPLSRSCTTEQTGELFSGGAKVRGLNVQVTASPVGRELASSLRSRASEPEIRQLAAS
PIFGAPKPFSSCPCSSSSRSSCAAHPSALLPEVCSFVSRRGARRNLGAQRGRGPGARGQRLGAAAGPTPVGKGTPGGAKG
QFRGGMSAQKGAVHQEPLRGRLEEDEEEEDEFEDDEFDDEDEGEDEGEDEEYDEEDDEDYDPMTPRGPLDNNNYGEVWLP
IQARPRRNRKNRAVRQLVQENLVKPSSLIYPLFVHDEETSVPIPSMPGQSRLSMEDLLKEVGEARSYGIKAFMLFPKVDD
ELKSVMAEESYNPDGLLPRAIMALKEAFPDVLLLADVALDPYSSMGHDGVVDEQSGKIVNDLTVHQLCKQAITLARAGAD
MVCPSDMMDGRVSAIRESLDMEGCTDTSILAYSCKYASSFYGPFRDALDSHMVGGTDKKTYQMDPSNSREAEREAEADAS
EGADMLMVKPGLPYLDVLAKIREKSKLPMVAYHVSGEYAMLKAAAEKGYISEKDTVLEVLKSFRRAGADAVATYYAKEAA
KWMVEDMKGTQKFTEPCY

Gene-Specific Links for TGME49_053900

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins