ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_053700 ()

transporter, major facilitator family domain containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15044

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI0785c sugar transporter, putative
  • PBANKA_081700 sugar transporter, putative
  • PY00954 major facilitator superfamily protein, putative
  • PVX_099230 transporter, putative
  • PCHAS_081730 sugar transporter, putative
  • PKH_071330 transporter, putative
  • TGME49_053700 transporter, major facilitator family domain containing protein
  • TGME49_058700 hypothetical protein
  • NCLIV_008080 hypothetical protein
  • NCLIV_027810 hypothetical protein, conserved
  • cgd2_1450 major facilitator superfamily protein, putative, 12 transmembrane domain
  • cgd7_3450 major facilitator (MFS) superfamily transporter containing 12 transmembrane domains
  • Chro.20159 transporter
  • Chro.70384 hypothetical protein
  • CMU_013380 major facilitator superfamily protein
  • CMU_023460 major facilitator superfamily protein
  • TA04000 integral membrane protein family I, putative
  • TA04005 integral membrane protein family I, putative
  • TA04010 integral membrane protein family I, putative
  • TA04015 integral membrane protein family I, putative
  • TA04016 integral membrane protein family I, putative
  • TA04017 integral membrane protein family I, putative
  • TA04018 integral membrane protein family I, putative
  • BBOV_III003420 transporter, major facilitator family
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_053700 transporter, major facilitator family domain containing protein
MVAADAHPRYPPQQEIILVHSSSPHSRTSAPTPSPVSRHGLRASGASEPYLMKQGGGPKQASGTMAGSQTPQGVWAEKGQ
TWQSAKASEQPSAREEIDRVSMAPTAAEVSNVSSRWNSAGDAPPGELSGHLRRTVSGEKRDHGSVEGKKKRGLSLLQRLR
QKCEDCRGREDCAAGADQKRTQPMRGDAGTHGISSRVVGRPSDVLPEHGAEESREHAADRRGDETKKADADGEFAPEVLE
AMQRNRNNEKMIVGVFCLMFALEIFVNFDSGVVPAILLTLQEQFHLDGAAAGLLGSLPYIGLVASSPFVGRGLTTFSPKW
FCLITMMVNLVATGLLGLAFNKLMLYLSRLLIGLSQSGFSIYAPVWVDQFAPADKLTLWMGLSQGGVVIGTMLGCVIAGS
FDTAAREGVETISWRYALLIQAIALFILLCIWMFFPRRFVDITMTKSTGEAGVSIEDATKADAAADATLLEEEGEDLDEL
ERNYGAAVTVASGSNGENSERMRSGGMRPLGDAETLDTSSIVVRRDGSGPGRESEENGPYDVKVADSRVPLPCVGLPQFR
KDILSNLLPLDFIATSPTFTRRASQVNPGPAPGSVNAARLSVSMAATAGDSGVPRPVGDVPVMLFDASETQQLPSAAEGP
GRAGLDGRELTTLSRLGPPPSSSPEAALAAASALEEGRDLLPGDGGGLWAHGRSAGPADVPVLHPYQSRGGQRASASVPD
IGSGRGRSPSTARLGQGGSASLANINARHSIPGGVAVRVGSISGPGEAAPGLLNRVGSTVSEVQYQMTFLTPHSTTLAFE
AFNWAAGTADPLLLVRTDARQPTHGDLTAVEMRGGAATSHRRRSNASSSVSESVHATQVPQGVASPRHRSGMGRVSGEEN
PVDAVGQASASQLSDGQTISEEESEARTEGQVIALAEFVEGGKRRGRGESEAENRTALEKEDGHGHPVEFDWRPPRRSTC
STTGGPRLMTLSRGSAEWDSEPHVEAFSAMPRTFGVWQSICILFESPIYVCVTIALCALFFEVTAIQFWSITYFQQELHV
PGAQVLVAFNATAATAPIVGVLAGGWFIDYLGGYKSEKGMLRTLLILGFWAVLCLFFGICASWVPNFIAIICFIWCILFF
GGGILPAATGIVIASVPVEVRAFGSGFCMMIYNVFGYVLGTLVPGAIIQAAGLTWGMRVVFLWSIFGVCGLFAAAFVCWR
LRIKPAYISYREKSSIKNEIEVGGVHEEE

Gene-Specific Links for TGME49_053700

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins