ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_052880 ()

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
apical during late intracellular tachyzoite
during not tachyzoite cell division

Who localised this protein by microscopy?

Gould, S. B., Kraft, L. G., van Dooren, G. G., Goodman, C. D., Ford, K. L., Cassin, A. M., Bacic, A., McFadden, G. I., Waller, R. F.
Ciliate pellicular proteome identifies novel protein families with characteristic repeat motifs that are common to alveolates. (2011 Mar, Mol Biol Evol) PubMed / full text
   more detail about this publication

apical during late intracellular tachyzoite, during not tachyzoite cell division
  • "The second T. gondii protein, TgME49_052880, is also located at the apex of the cell in close vicinity of the conoid, but in this case forms a smaller focus than the rings formed by TgME49_044470 (fig. 4J and K)."
  • Microscopy type:
  • Microscopy method:
  • Strain: RH Ku80-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: focus at apex during mature intracellular tachyzoite, not during daughter cell formation
  • Comment: genomically integrated, native promoter
  • Other genes localised in this publication: viral A-type inclusion protein repeat family

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10046

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_052880 hypothetical protein
MAPSNAQPSAGPVPIAIGSLSPPSSLASPSSASASFALPSPVPGSSRAASLHFPSWNSHPLPPGFSLSSPPSPANADCDL
RVRQRSSAAAVCISASPQHATASRPLHALAERPESRAVQASSSALSCPGAVAASSEAARTAEADRLSERPVHLPALAESR
RGAPEDGVEFQGKRIAPPLHPPSSSPPASPSARSTVSLTSYFSFSAAPPPLSPSRVPPVFSPAPITAAPCPSHRSVSSAV
RGETHTPRHKSSASYRLPCQLPVLPPSSRPTPEDDRGEGFCETASTAVAARGPRGLRDSSGDNLEACSFSAASHKRSASR
GLEEGSRMRAQSAGGDRQGLRGRQRQGRACIACQSRHRTRTVDAAELRRNGDESSADEVDDGFPYLLEQSIRLAEPQSYA
APATSAAPATSAAPATSAAPATSAAPATSAAPAAAPKDRPRRVAPSFPLSAAPRRLQTPAEEARRFLSWHPPESRAASAE
ASAVSSAVDRDPSLWLLREACRNPDEGNVYRLVLEQVMRGRCLRRPLEDVPSADFSEQVQRLKHSVHSALEQCTGFRCHS
VSRGSPKGKRRRGEAPAVREDACRPSELRAAVAVSRDLYAENTFLEQFVTKGDRVLQTKELARYREAIGKLEQENKSLRQ
RVTEERNQTLSFFRQRCALDLLLQSVAAQLGEDDQRELLSRMRLCAASCVAIDWRDQKRGPGDKAAAAASDLQPVAGFSF
ADLLPCAVSALEELAASKGAKRGVRGEPGGDEKAWGVGGRRETLGVSGGAGRARAGLGAESCLSSRARSVCASPRERETA
EQSTARAQRGVHDQLAGLRSLLIDKEAALNSALLERDGQRAEIRQLKSLLEGREEATVAAKRDVEDENARLKATIKSLQE
SLKSTEEKFQEKSQRTEGLVAELQSQIAEARQSLAEERATLKAREEELARRAAGDGQAETAALQKKLEEDVHAKLQAEVV
ALRAKAARSDSLEAELEAKKQLLAAEAAKVGDLEAKLRETEARNEELEQVVARLREDLAAAAGKAKDQVSAPLESGKDST
VAKSVKSKPLLPPPGKGAKASASVPLSTDVSVLQTEVATLLAENQRLALALQEATLREAAAAAGAPDRAAPSPGHVAKKS
LPPSKATSASPAEPLGAKTAETPSSAGAQGLASGLAKKFAAAEKPKAKGMFAALRRTLSRSSSPAQKASPPPSPRSAGGS
SDEVAKLRAQLEKMREELARALEQKNILSGHEATAGAAGAALGTSGKAKTPAKVGPKKAAPALEASAETATKQIAELKRE
NEALRQRIAELEAFKPSEPGGEKAAPAATQGPPAQKGAVPPKMGVVPPKKAARLQPAQTQGDSERSTNLGEAEEVKRLRS
EVDRLQLEKERLEAELKQERQELVELKQTVRSPSATLGGSKKVSPVGAAKLKGMPPPKASSPAVPAASHADEEMQTLRSA
LSEVQKERDELKKRLESLESAEKRDETKKDAPQPEAAGKAGPPKKAGPSKKPPLVGAKKAASPAPPAVDAAVSEAPGAAE
ASPIAAVDLQDIEALKKEVEALRAQLVASEGAKAALEEKLKTAEAPKSKASPPAKAKLAPVPKNAGGTDARVGYTGVGDT
GEKLRELEVEVKELRAEKAALLEENAKLKREGSQVVQGQPASEDQGKPVPGKKAGPVGGKVPPKATAKAPASEAPTSGHE
ATETQRKLEELEVEVKTLRAENEALAKDLAKLKKEREDAPQGEEAKAGGKTAVPKKSPPKPGALPAKKAAAPVAKAEEEQ
KPGGSVGMDSKLEEKIAALEMENRTLRDELARVKEQVKQSAKAREETPQTAEPSSAGKAAPPFGVVKAKGPPKKALPASA
TSICATTGEAEQNEAQARLAALEEETRELREKAKHLEAERDTLKRQVDELKQAEAKPRGGGQEREERSEEGDAPAKAGAK
GGKPPPPKKKPAVPAPKAKEGVEEKGEGEGKDEVKTEDITKMKEEIDRLTKEKEELQEEVTALKGAAEKREETAGGEKAE
ETQAMKQEIERLKKENAELQKKLADLSVATEKREEASGEGDAPAKAGAKGGKPPPPKKKPAVPAPKAKEGVEEKGEGEGK
DEVKTEDITKMKEEIDLLTKEKEELQKEVTAIKGAAEKREETAGGEKAEETQAMKQENERLKKENAELQKKLADLSVATE
KREEASGEGDAPAKAGAKGGKPPPPKKKPAVPAPKAKEGVEEKGEGEGKDEVKTEDISVQLEELRKENEHLKRCLESVAK
DGGAPASGASQEMKRLQEELEELKKEKEKSKAEETNAGGAGGAADVEKLKAVEAENENLRKQLSELQKASPTAPASEKKE
ENADAPSEKKEDDSKTVVALQEEIRVLKEEKGSLEKRLQEATSASPPAAVKSKSAPPPKKAGAAPKDAEGAAKDEAGDAK
ALEAKVAALETENKKLKAHIASLTPAAAGKEGISVQEGQKLEKRSSILKVFDDEDGLDRQWSVVVPAAGDLIPVAKYESA
KAKYEKLLDAYRRQKGKIASFEADASQYAEERETLQTQVTDLQGELRRTRAELGVFQELEKKQEEEQKKNEEAEAQAAGS
IFSFWGGGAEAEPAEAAPAEKTNEAEGQVKLLKVKVKNLQEEKQMLESKLEKMQSKLEAARSGAGSMATIPTIEDLKRSS
GGGEEKSEAGGESSSEVTKKIATLQKELEEGRVREQKLQEEVTKLKKVLEGLEKGTKSEQGEKPEQTQEETGREVQKRLE
EVEKERDELKVKLSEKEEEIKKLKGETETLEKDKSDLLKKVAALEEEMKGLREQAATESAKASVAEAEPSQKEHEEKEKK
EKAKKEKKEKEGKDKQEQEEKKKEQEEEQAKQAKEEQEKKEKEEKERKKKEKKEQAKREKEEQEKKEKEEREKKEKEEQE
KKEKEEREKKEKEEQEKKEKEEREKKEKEEQEKKEKEEREKKEAEEKEAAQAEEPAPDQGGGMFSWFGGGAAAAPEQSET
EPPSEEEKEEGGGFLSAFGFGAPAPPEKEEEPSILRLSTAPQEGQEDAPKAADATSDASSEDEAEAGIASSIAGYFWGF

Gene-Specific Links for TGME49_052880

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins