ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_052640 (PMA1)

plasma-membrane H+-ATPase, putative, a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during bradyzoite
during not tachyzoite

Who localised this protein by microscopy?

Holpert, M., Luder, C. G., Gross, U., Bohne, W.
Bradyzoite-specific expression of a P-type ATPase in Toxoplasma gondii. (2001 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during bradyzoite, during not tachyzoite
  • "Stage-specific expression of TgPMA1 was further analyzed by indirect immunofluorescence using a polyclonal antiserum generated against a peptide of TgPMA1 located at the carboxy terminal region. Confocal microscopy revealed a specific membrane staining of mature bradyzoites isolated from brain tissue of chronically infected mice (Fig. 3). Internal structures of the parasite were not stained, demonstrating that TgPMA1 is exclusively located at the plasma membrane."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein epitope AVDQKNREVSRSSGK
  • Strain: P
  • Gene model mapping comments: Blast from AJ278874.1, annotation matches
  • Localisation record: plasma membrane during bradyzoite, not during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10717

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_052640 plasma-membrane H+-ATPase, putative
MDEASRRAAELEAAADKLEQTETVTVNYDTRGLTSDQVADLRKKYGWNEVKPHQVPEWFKVLKKYLSLVPMLLIVAALFS
VCVVEDNMRDWFSFALLLFLNNSMVWADYIGQRSAHNAIAAVEKLGAPVCQVKRDGQWQNRQVRDLVPGDVVHLKAGVIM
PADGVFVTKGTTITVDESALTGESVPIRKRPGAPLLSGSVVDRGEGEMLVTKTGNDSFYGKTLSLLARAERQGYLETVLH
RTSLFITFVASCCAAFLFFWQSFNSDWKLIIPERRYLIALKHAFILIASVAPAAMPVVTTTVLSVGALIITKQNAAVSRL
SAIEEAAGVVILFSDKTGTLTKNQLSLFKEESMIEPGYDEETMLLYASLCSDTQEPEPIDRTINAAADMTERAKYQILEY
VPFNPVDKRTEATVVSPEGKKFITTKGAPHVIRDLVCYEDQKLREQLNELILNKAKRGLRTLGVAVKPVPDGVAGDAPRW
KLVGYLSLFDPPREDTAATIQRANELGIRVIMVTGDQQAIAVETARQLHMGTNIVGPEIWKEEKETGLVQGKALAEFIET
VDGFAGVFPEHKYAIVNAMMDAHKLVAMTGDGVNDAPALKRATIGIAVSGATQAARAAADIILFAPGLKTIITVMSLSRQ
IFKRVESYIIFRIYTSLIILGMWWGCIVILRYQFPSWTLVLMSMINDFVLMSCSRDRVASSTSPMIWSMLRVICLSTWLG
FLATVSILLYVVFADPSHCVNWWPRWGLPKFTPDWPLPVSEHFMSYQTNAGVWLLMTVLIQFSFQSVRTRGLFCRYNENN
QFPALVIIIPQICAVVVTIFLSIYWKIAWRPGSGPRMVGINWGQAWVTIFWGILWFFVMDATKIGFYKYAWPVITRNVVY
KSIAETACQREIENNNVASKVMQNTVHFLEERERNVEKLEEKVEDAFLAAVTDAGELVKNDHGKSHIDRKEHKVSPEPGK
TSTEDEVSLPRKDANSFVVSITSEEGACRTGFDDADAGTAKHRVAVDQKNREVSRSSGKTSIPLHPDVGKGCAVPSITR

Gene-Specific Links for TGME49_052640

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins