ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_052220 ()

Hsc70/Hsp90-organizing protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11644

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0324 Hsp70/Hsp90 organizing protein, putative
  • PBANKA_101050 Hsp70/Hsp90 organizing protein, putative
  • PY03138 stress-induced protein sti1-like protein
  • PVX_084820 hypothetical protein, conserved
  • PCHAS_101140 Hsp70/Hsp90 organizing protein, putative
  • PKH_131500 hypothetical protein, conserved in Apicomplexan species
  • TGME49_052220 Hsc70/Hsp90-organizing protein, putative
  • NCLIV_007330 Similar to uniprot|P15705 Saccharomyces cerevisiae YOR027w STI1, related
  • cgd2_1850 stress-induced protein sti1-like protein, putative
  • Chro.20201 stress-induced protein sti1-like protein
  • CMU_036720 TPR repeat-containing protein
  • TA18515 hypothetical protein, conserved
  • BBOV_III002230 tetratricopeptide repeat domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_052220 Hsc70/Hsp90-organizing protein, putative
MSATEAAQALKAKGNAAFQEGKYEDAVGFFTEAIKCTPDDAVLYSNRSGAYASLNKLEEALNDAEMCVKLRPTWGKGYSR
KGLAEFRMMKYKEAEATYHKGLQVDPTNEQLKEGLNQVQQQTDQFFSMQAMLAAAQAVNKHPKLAKYQQEDPEYTHRLTE
ILKQIQKNPQSLKLIMAQPDVRVKEGVIAAMGGDLEEEEELPQSRTAAGPTRGSAENASATKAAAGVKAAEQPAKELTKE
EQEAEELKQKGNELYKQKKFEAALEAYDEAIEKNPNEILYLNNKAAVYMELGDYDKCLAECQKALDKRYECKADFSKVAK
VYCRMAACKTRSGDYSGAIAMYEKALCEDNNRMTRNALNEVKKLKEKKEKEDYINPALAEQHREKGNEYFKQGDYPAAKK
EYDEAIRRNPKDAKLYSNRAAALTKLCEYPSALRDADTSVQVDPAFVKGWSRKGNLHMLLKEYPKALQAFDKGLALEPTN
QECIQGKMAVMNKVQQLQSSGEVDPEQMAHSLADPEIQAILKDPQMNIVLMNIQEKPELIHEYLRDPKIKDGINKLIAAG
ILRVA

Gene-Specific Links for TGME49_052220

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins