ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_051950 ()

ribosomal protein L7/L12, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10326

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFB0545c mitochondrial ribosomal protein L12 precursor, putative
  • PFE1225w organelle ribosomal protein L7/L12 precursor, putative
  • PBANKA_030900 mitochondrial ribosomal protein L12 precursor, putative
  • PBANKA_123940 organelle ribosomal protein L7/L12 precursor, putative
  • PY03559 ribosomal protein L7/L12
  • PVX_002920 50S ribosomal protein L7/L12, putative
  • PVX_080020 50S ribosomal subunit protein L12, putative
  • PCHAS_031120 mitochondrial ribosomal protein L12 precursor, putative
  • PCHAS_123980 organelle ribosomal protein L7/L12 precursor, putative
  • PKH_040800 ribosomal protein L7/L12, putative
  • PKH_100760 50S ribosomal subunit protein L12, putative
  • TGME49_051950 ribosomal protein L7/L12, putative
  • TGME49_089230 50s ribosomal protein L12, putative
  • NCLIV_041600 50S ribosomal protein L12, chloroplastic, related
  • NCLIV_066990 hypothetical protein
  • TP02_0775 60S ribosomal protein L7/L12, putative
  • TA03950 50S ribosomal protein L12, putative
  • TA15030 ribosomal protein l7/l12, mitochondrial/apicoplast, putative
  • BBOV_III003310 hypothetical protein
  • BBOV_IV003600 ribosomal protein L7/L12
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_051950 ribosomal protein L7/L12, putative
MANVVAKGFGVSPYWNSVRIHRSFPSNLATGRSGQRGFHCVESSLLNVSSPRSLSGTPLPELSTCINGGMLAVQGFGAWA
KSAQSACVPYHQNGWHQISSQAAFGTAPAASFDIFQKLKDPPEAGEDAGATAKKRKPSDRVIRLVDEVMNLTLIEAADLC
DLCQEKLAERSGGPTFNAAAAAGRTPFPHPVGMFAGMAMPGMMGGMTAPVGMMPPMAAAPAATAGPTSAAPPEAAAASEK
KPEKKEDTKAAFSIKLLGFDAPKKVAVVKEVRAITALGLKESKDLVEQAPKIIKKAVPAAEAEALKAKLEAAGAQVALE

Gene-Specific Links for TGME49_051950

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins