ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_051930 (ENR)

enoyl-acyl carrier reductase, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during bradyzoite and early multinucleate tachyzoite and extracellular merozoite and macrogamete and microgamete and multinucleate mid-stage schizont and tachyzoite

Who localised this protein by microscopy?

Ferguson, D. J., Sahoo, N., Pinches, R. A., Bumstead, J. M., Tomley, F. M., Gubbels, M. J.
MORN1 has a conserved role in asexual and sexual development across the apicomplexa. (2008 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during early multinucleate tachyzoite

Ferguson, D. J., Henriquez, F. L., Kirisits, M. J., Muench, S. P., Prigge, S. T., Rice, D. W., Roberts, C. W., McLeod, R. L.
Maternal inheritance and stage-specific variation of the apicoplast in Toxoplasma gondii during development in the intermediate and definitive host. (2005 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during bradyzoite and extracellular merozoite and macrogamete and microgamete and multinucleate mid-stage schizont and tachyzoite
  • "When tachyzoites located in the lung and brain of acutely infected mice were examined by immunostaining with anti-ENR, a small positive-staining structure, the apicoplast, was observed just anterior to the nucleus (Fig. 2c)."
  • Microscopy type: Light
  • Microscopy method: Polyclonal antibody to whole protein
  • Strain:
  • Gene model mapping comments: Blast from P. falciparum orthologue PFF0730c, annotation matches
  • Localisation record: apicoplast during tachyzoite and bradyzoite and multinucleate mid-stage schizont and extracellular merozoite and microgamete and macrogamete
  • Comment: strain information ambiguous
  • Other genes localised in this publication: SRS29B (= SAG1, P30), bradyzoite antigen, putative, enolase 2, nucleoside-triphosphatase I

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13747

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_051930 enoyl-acyl carrier reductase
MVGFKLLTLGAFVAGELTLVGPAGTMAFTVPNATGAKPLVTSVSVRPSWSSARQNAFSSSSSRSQSSVRPHSAFVTNRLE
TAGETGTQHRAADSAAGVGAAQSAFPIDLRGQTAFVAGVADSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGR
LDEDRKLPDGSLIEFAGVYPLDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPL
LETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKAALESDTRTLAWEAGQKYGVR
VNAISAGPLKSRAASAIGKSGEKSFIDYAIDYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQA
VDSRSMPPLQRATQEIN

Gene-Specific Links for TGME49_051930

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins