ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_051850 ()

serine/threonine protein phosphatase 5, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_17104

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0224 serine/threonine protein phosphatase
  • PBANKA_102010 PP1-like protein serine/threonine phosphatase, putative
  • PY00015 hypothetical protein
  • PY00016 PP1-like protein serine/threonine phosphatase-related
  • PVX_085315 PP1-like protein serine/threonine phosphatase, putative
  • PCHAS_102090 PP1-like protein serine/threonine phosphatase, putative
  • PKH_132580 PP1-like protein serine/threonine phosphatase
  • TGME49_051850 serine/threonine protein phosphatase 5, putative
  • NCLIV_066900 serine/threonine protein phosphatase 5, putative
  • TP01_0219 serine/threonine protein phosphatase, putative
  • TA19470 pp1-like protein serine/threonine phosphatase, putative
  • BBOV_IV005220 serine/threonin protein phosphatase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_051850 serine/threonine protein phosphatase 5, putative
MGSRGFAEKPEAAAQGRAMEVYEPPFQVGSWGRWLRTQGSVIHSRLILVASVMGFSIGDVVAVYGHKAHIRYVGPLPPNP
FGKKQKVSQTGFGVEFSDRKLGDNDGSVDGKQYFKCKLGMGLFVTENRARPYDEKDCSATQLQAAWRSYRARQAFQDAAA
FNFWNELDAFEEKDALVKNRDVGTPTLNTIKKQIHEQSMVDTLEETNERDQASYLAVPGTDANRGSAPPRSRRRSSTRRS
FGRSSVDASSISAENIPDDYAGPRVKWPITREFCLDLVDHYRDNPDVPLPRKYALELIMAITDHYRETMKGAVVEVEIPK
KGGSRLVLVGDTHGQLNDVLWIFYKFGPPSATNVYLFNGDIADRGRYAVEIFMMLFAFKLQCPSSVVINRGNHESADMNE
VYGFAQEVRQKYGGFMYQKFQEVFHLLPLCVVMEKRVFVVHGGLCRKDNVTLQHIDRLNRQRPCPACPHSFEDTLMFDLL
WSDPQHESGRGWSTRGADCIAFGPDITDAFLTKNNLEVCIRSHQVPTNLRGFEPVHDGRCVTLFSASNYCGTTGNFGGVI
IFEANLSFEIQEYMAPSLEEIQMLHSETCAATQKVFLQTRIKYLEMQAKRQHRRTAAARMNEQIIEKICKMICEKKTDLW
WCFFNMGAESGRVTPAQWREACANVLGRNFPWVYLMKRLHVVEEDGYVYYNEFLNRYRVEFRPPKCKHLNWRRECIARVF
ESIMSADLSLKETLMLFDRNCDGTVSFREFNELITELDVGLSEPQVRILMRLITASPAFNAAAGSIDVAEFLGRFRVVYS
HVINDDKRSVPWLQRALHCIGKAILADKAEAANRHYEQQRQDGNLGPDLNTRRRSSAVRAVALFQKFKDYNEGGDGYLSY
ADFVTGIKRLTIDEEELGFALTDEHLYKVAEAVDTTGSKRINYLEFLQAFHVVDSNSNNSAAEELWGQICTAIFQHKSSI
RRALHQFDPDMTGKVDSEDFRSALVTVNTVLSRTEAPLTEEQIDQLVNTMDLNNEGMVEYEEFLDSFSPVDTFFLQPGGE
DEPSKTSNGPQNGKETLEETDASPTDNEVASNSRRFTLSSTLSQSA

Gene-Specific Links for TGME49_051850

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins