ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_051810 ()

translation initiation factor eIF-5A, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10355

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL0210c eukaryotic initiation factor 5a, putative
  • PBANKA_060320 eukaryotic initiation factor 5a, putative
  • PY00983 translation initiation factor eIF-5A
  • PVX_084255 eukaryotic translation initiation factor 5A
  • PCHAS_060500 eukaryotic initiation factor 5a, putative
  • PKH_130290 eukaryotictranslation initiation factor 5a, putative
  • TGME49_051810 translation initiation factor eIF-5A, putative
  • NCLIV_066870 hypothetical protein
  • cgd7_2300 translation initiation factor if-5A
  • Chro.70262 translation initiation factor 5A2
  • CMU_034350 eukaryotic translation initiation factor eIF-5A, putative
  • TP01_0884 eukaryotic translation initiation factor 5A, putative
  • TA06205 eukaryotic translation initiation factor (eIF5A homologue), putative
  • BBOV_IV008910 translation initiation factor 5A, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_051810 translation initiation factor eIF-5A, putative
MSDAEDVTFETADAGASHTYPMQAGAIKKNGFVMLKGNPCKVVDYSTSKTGKHGHAKAHIVGLDIFTGKKYEDVCPTSHN
MEVPNVKRSEFQLIDLSDDGFCTLLLENGETKDDLMLPKDSEGNLDEVATQVKNLFTDGKSVLVTVLQACGKEKIIASKE
L

Gene-Specific Links for TGME49_051810

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins