ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_051760 ()

proteasome activator subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14480

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI0370c subunit of proteaseome activator complex, putative
  • PBANKA_080910 subunit of proteaseome activator complex, putative
  • PY04117 Proteasome activator pa28 beta subunit, putative
  • PVX_098830 proteasome activator complex subunit 3, putative
  • PCHAS_080940 subunit of proteaseome activator complex, putative
  • PKH_070490 subunit of proteaseome activator complex, putative
  • TGME49_051760 proteasome activator subunit, putative
  • NCLIV_066820 proteasome activator subunit, putative
  • cgd8_3090 proteasome activator p28/ Ki autoantigen
  • Chro.80360 subunit of proteaseome activator complex
  • CMU_023610 proteasome activator pa28 beta subunit family protein
  • TP02_0839 proteasome activator complex subunit, putative
  • TA15430 subunit of proteaseome activator complex, putative
  • BBOV_II005350 subunit of proteaseome activator complex, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_051760 proteasome activator subunit, putative
MASTSVLSSLAAAGLDKLDKLEPSDQSVKKEYEQFKKDLTRQAVISLKDRIPRKILHFNNLTNVNADPGSLFPSADMAQM
SKGEGKHAESGDCDTSVTTSGSLPPGKRIKLDDGRMCYTHVMPRHGQICEQLEQLKRDAAELVETLGQVKLWIQLNVPRI
EDGNNFGVGIQEEAIQELARVEDWAFNLYDAIFKYYMARAKLSTKVLKYPNVGDYWEAIRELDEKELLHIKFTKVDMRNN
YSMLYDLLCKNWEKVVKPKNEDTRSRMTF

Gene-Specific Links for TGME49_051760

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins