ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_051680 ()

translationally-controlled tumor protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11073

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_111050 translationally controlled tumor protein homolog, putative
  • PY04896 translationally controlled tumor protein
  • PVX_080685 translationally controlled tumor protein, putative
  • PCHAS_111020 translationally controlled tumor protein homolog, putative
  • PKH_102200 Translationally-controlled tumor protein homolog (TCTP)
  • TGME49_051680 translationally-controlled tumor protein, putative
  • NCLIV_066760 Translationally-controlled tumor protein, related
  • cgd3_1940 conserved hypothetical protein
  • Chro.30228 histamine-releasing factor
  • CMU_001630 translationally-controlled tumor protein, putative
  • TP01_0276 translationally controlled tumor protein, putative
  • TA21460 p23 (translationally controlled tumor protein homolog), putative
  • BBOV_IV004730 histamine-releasing factor, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_051680 translationally-controlled tumor protein, putative
MKVYKDVFTGDELCSDSYAELPPMDDPSLSEVAFEVATKRIVKGAEDYGIADNSEEDGGGVDSTSETVVDVVDAFRLQET
PFSKKEFGTYIKGYMQRVKGHLEKNHPDRVDKFMSGAQALVKKILGQFDDFQFFLGESADCEAGVVFAYYKDGEEAPRLI
YIRDGLKEEKY

Gene-Specific Links for TGME49_051680

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins