ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_051540 (GRA9)

GRA9 protein, putative, a gene from Toxoplasma gondii

Compiled localisation
dense granule and membranous parasitophorous vacuole tubules and parasitophorous vacuole during tachyzoite

Who localised this protein by microscopy?

Adjogble, K. D., Mercier, C., Dubremetz, J. F., Hucke, C., Mackenzie, C. R., Cesbron-Delauw, M. F., Daubener, W.
GRA9, a new Toxoplasma gondii dense granule protein associated with the intravacuolar network of tubular membranes. (2004 Oct, Int J Parasitol) PubMed / full text
   more detail about this publication

dense granule and membranous parasitophorous vacuole tubules and parasitophorous vacuole during tachyzoite
  • "Here, we confirm by immunofluorescence and by cryo-electron microscopy that the recently isolated B10 protein (318 amino acids, 41┬ákDa) is a new dense granule protein that should now be referred to as GRA9."
  • Microscopy type: Light and EM
  • Microscopy method: antibody directly to protein
  • Strain: BK
  • Gene model mapping comments: Blast from AJ223585
  • Localisation record: dense granule and PV and membranous PV tubules during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_116233

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_051540 GRA9 protein, putative
MRSLKSIVVPLSAALVAAAELDLFLGESGVYLFGKASESDVALKVPEDPVPEEPRREPEKHVDLFGEDWKQFGGSGFGDF
SKVEFENLFSQVHEMMRRLMGRGVDGFGPSLLGDSPGFHFPRLRALQPKTKLEKTGTCQYVVTWAPEVTAENVRVILHLQ
RRQVEVQYRAATRRDEKTEGGESHSMSKEQSSQLMSVDPQCIMTREVVAQKLAGWTDNTHTATAGTPKKLLISFPSPDHI
KEMVKEGYLPDNALERVLAGDFEGFSRTQMCLVSGRNRTECAFAEGQEVELEEKPLPSDSSPVTSVELPRLSQEDRGL

Gene-Specific Links for TGME49_051540

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins