ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_050340 (Centrin-2, Centrin2)

caltractin, putative, a gene from Toxoplasma gondii

Compiled localisation
apical annuli and basal and cytoplasm during tachyzoite
centriole during intracellular tachyzoite and late intracellular tachyzoite and tachyzoite
apical and cone shaped body of basal complex during late intracellular tachyzoite
centrosome during g1 phase of intracellular tachyzoite and mitosis of intracellular tachyzoite and s phase of intracellular tachyzoite
basal complex and preconoidal rings and series of annuli further down the cell periphery in the apical end of parasite during intracellular tachyzoite

Who localised this protein by microscopy?

Beck, J. R., Rodriguez-Fernandez, I. A., Cruz de Leon, J., Huynh, M. H., Carruthers, V. B., Morrissette, N. S., Bradley, P. J.
A novel family of Toxoplasma IMC proteins displays a hierarchical organization and functions in coordinating parasite division. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

basal complex and centriole and preconoidal rings and series of annuli further down the cell periphery in the apical end of parasite during intracellular tachyzoite
  • "7E8 staining is delimited at both its apex and base by TgCentrin2, which labels the preconoidal rings as well as a series of annuli further down the cell periphery in the apical end of the parasite. The 7E8 apical spot does not colocalize with TgCentrin2 annuli (inset arrows). TgCentrin2 also localizes to the centriole and the basal complex."
  • Microscopy type: fixed light
  • Microscopy method: mRFP tag
  • Strain: RH hpt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: preconoidal rings and series of annuli further down the cell periphery in the apical end of parasite and centriole and basal complex during intracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein, hypothetical protein, hypothetical protein

Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B.
Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

centrosome during g1 phase of intracellular tachyzoite and mitosis of intracellular tachyzoite and s phase of intracellular tachyzoite

Hu, K.
Organizational changes of the daughter basal complex during the parasite replication of Toxoplasma gondii. (2008 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

apical and centriole and cone shaped body of basal complex during late intracellular tachyzoite
  • "The TgMORN1 compartment is shaped into a cone that forms the main body of the basal complex (Figure 1A-1E), whereas TgCentrin2 is concentrated at the posterior tip of the basal complex (Figure 1D and 1F). Both TgCentrin2 and TgMORN1 are also components of the apical complex. In addition, they are localized to the spindle pole and the centrioles, respectively."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Cone shaped body of basal complex and apical and centriole during mature intracellular tachyzoite
  • Other genes localised in this publication: phosphatidylinositol-4-phosphate 5-kinase, putative, membrane skeletal protein IMC1, putative, tubulin alpha chain

Hu, K., Johnson, J., Florens, L., Fraunholz, M., Suravajjala, S., DiLullo, C., Yates, J., Roos, D. S., Murray, J. M.
Cytoskeletal components of an invasion machine--the apical complex of Toxoplasma gondii. (2006 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

apical annuli and basal and centriole and cytoplasm during tachyzoite
  • "In accord with its more divergent primary sequence, EGFP-TgCentrin2 shows a dramatically different localization (Figure 7). In addition to diffuse cytoplasmic and bright centriolar fluorescence, highly localized patches of TgCentrin2 are seen at the extreme apical and basal ends of the parasite, and in a ring of five to six small patches around the circumference ~1.5 ?m from the apical end of the cell (Figure 7). In transgenic parasites expressing both Centrin2 and TgDLC, the ring of TgCentrin2 always coincides with the lower edge of the apical cap of dynein described above (Figure 8). A smaller and weaker basal cap of dynein is also seen surrounding the basal spot of centrin2. EM images (Figure 9) of immunogold-labeled parasites show that the apical circumferential patches are in fact annuli (the central clear space is seen only when the direction of view is appropriate, as in Figure 9B). EM images also reveal that the extreme apical-endヨlabeling is confined to the preconoidal rings. "
  • Microscopy type: Light, EM
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm and centriole and apical annuli and basal during tachyzoite
  • Other genes localised in this publication: membrane skeletal protein IMC1, putative, calmodulin, putative, calmodulin, putative, dynein light chain, putative, phosphatidylinositol-4-phosphate 5-kinase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21068

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_050340 caltractin, putative
MLIYVKTVLEEQEPIYPIEGKTVLCWTECHFLDEGSRSSWANGCLECEKPVANPLDTGYTESPLSLHSLAPKRRGALRGA
SPTARRRLVDRPGLTEDEIEEIREAFNLFDTDGSGMIDPKELKAAMQSLGFETKNPTIYQMIADLDRDSGGPIDFEEFLD
AITAKLGDKESREGIQKIFSLFDDDRTGTITLKNLKRVAKELGETMSEDELREMLERADSNGDGEISFEDFYAIMTKKTF
P

Gene-Specific Links for TGME49_050340

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins