ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_049910 ()

mitochondria-associated granulocyte macrophage CSF signaling molecule, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27219

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFE0670w mitochondrial matrix protein, putative
  • PBANKA_111320 conserved Plasmodium protein, unknown function
  • PVX_080565 hypothetical protein, conserved
  • PCHAS_111280 conserved Plasmodium protein, unknown function
  • PKH_101900 conserved Plasmodium protein, unknown function
  • TGME49_049910 mitochondria-associated granulocyte macrophage CSF signaling molecule, putative
  • NCLIV_066030 mitochondria-associated granulocyte macrophage CSF signaling molecule, putative
  • CMU_025030 hypothetical protein, conserved
  • TP02_0751 hypothetical protein
  • TA14910 hypothetical protein
  • BBOV_IV003470 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_049910 mitochondria-associated granulocyte macrophage CSF signaling molecule, putative
MAIGPLGRILAQFVVVAGSAVGRAVVQAYRDAAKRGAFNATGAAGRQSLTLRSRMSADEARRILGLDSSGSSSAPLCRQD
IEARHKRLYEINAPSGTFAGSPYLQKKVNIAKVILLEKLEEDQRATTKDKNKDPQK

Gene-Specific Links for TGME49_049910

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins