ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_049900 ()

ADP/ATP carrier, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10293

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF10_0366 ADP/ATP transporter on adenylate translocase
  • PBANKA_052020 ADP/ATP transporter on adenylate translocase, putative
  • PY03882 adenine nucleotide translocase
  • PVX_110895 ADP/ATP transporter on adenylate translocase, putative
  • PVX_250300 ADP/ATP transporter on adenylate translocase, putative
  • PCHAS_052040 ADP/ATP transporter on adenylate translocase, putative
  • PKH_062160 ADP/ATP transporter on adenylate translocase, putative
  • TGME49_049900 ADP/ATP carrier, putative
  • TGME49_100360 mitochondrial carrier domain-containing protein
  • NCLIV_060320 mitochondrial carrier domain-containing protein, putative
  • NCLIV_066020 hypothetical protein
  • cgd8_1210 mitochondrial ADP/ATP-transporter, integral membrane protein with 4 transmembrane domains
  • Chro.80141 ADP/ATP carrier
  • CMU_025140 carrier protein, putative
  • TP02_0141 adenine nucleotide translocase, putative
  • TA11570 ADP/ATP transporter, putatve
  • BBOV_III010060 adenine nucleotide translocase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_049900 ADP/ATP carrier, putative
MAAPTVSAGGKEKKGNADSQLMNTAKDFLAGGISAGVSKTIVAPIERVKMLIQTQDSIPEIKEGKIPRYTGIVDCFRRVS
AEQGVASLWRGNMANVIRYFPTQAFNFAFKDTFKRMFPRYDQKKEFWKFFCTNVASGGLAGASSLVIVYPLDFARTRLAS
DVGKGNEREFTGLVDCLGKIFRRTGFFSLYQGFGVSVQGIIVYRGAYFGLFDTAKAMLFGPNNDANLFYKWAVAQTVTAA
AGVASYPFDTVRRRMMMMAGRKKGEQEIQYTGTADCWKKVYQQEGFKGFFKGAWANVLRGAGGALVLVFYDELKKMLM

Gene-Specific Links for TGME49_049900

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins