ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_049850 (GAP40)

hypothetical protein, conserved, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex

Who localised this protein by microscopy?

Frenal, K., Polonais, V., Marq, J. B., Stratmann, R., Limenitakis, J., Soldati-Favre, D.
Functional dissection of the apicomplexan glideosome molecular architecture. (2010 Oct 21, Cell Host Microbe) PubMed / full text
   more detail about this publication

inner membrane complex
  • "The generation of transgenic parasites expressing a C-terminal tagged version of this protein identified a resident polytopic protein of the IMC with an apparent molecular weight of ~37 kDa (Figures 1B and 1C)."
  • Microscopy type: fixed light
  • Microscopy method: Ty tag
  • Strain: RH
  • Gene model mapping comments: blast from HM751080
  • Localisation record: inner membrane complex
  • Other genes localised in this publication: hypothetical protein, myosin light chain TgMLC1, myosin-A docking protein, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23125

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_049850 hypothetical protein, conserved
MSTLQDIRLPTWQQIRRFVQDPEIVTAEVLFLILTLSNVFVMYRLFLDVVPYPVFVTWWQLAQGLFMAWCLGETGKEFPK
FAYFPRVEFDKKLLKKLVVPSIVNAFMLVLANVVLYRTNCVATLPVTVSFAVVLHHVTRFIGCGEEYMPMRWQAVGLLML
AFVLGCTDSMTVGAQVLPWAVLYSIFSAAFRAAYLQKVMHEVDGRGNLLYNHQHIIGVALLPILCLVCGESRVITSMPMN
FTLLHTWQVWGCLVTVGALPFLKNIVSNRLIRRTGQAPWRFLEIVSIALVFLIGLGFGVPGWQGFICILLVLAGRTFCAY
DVIMNAADVEAARETRGGSRAPQELGDANELETGSQSSQKPFLQAIQEDGGENYADVCDDEAHSS

Gene-Specific Links for TGME49_049850

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins