ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_049670 (tgcp1, toxopain-1, CP1, cathepsin B, CPB)

cysteine proteinase, putative, a gene from Toxoplasma gondii

Compiled localisation
endosomal vacuole and parasitophorous vacuole and rhoptry during intracellular tachyzoite

Who localised this protein by microscopy?

Que, X., Ngo, H., Lawton, J., Gray, M., Liu, Q., Engel, J., Brinen, L., Ghosh, P., Joiner, K. A., Reed, S. L.
The cathepsin B of Toxoplasma gondii, toxopain-1, is critical for parasite invasion and rhoptry protein processing. (2002 Jul 12, J Biol Chem) PubMed / full text
   more detail about this publication

endosomal vacuole and parasitophorous vacuole and rhoptry during intracellular tachyzoite
  • "The T. gondii cathepsin B localized to rhoptries, secretory organelles required for parasite invasion into cells. "
  • Microscopy type: Light, EM
  • Microscopy method: monoclonal antibody
  • Strain: RH
  • Gene model mapping comments: Blast from AY071839.1
  • Localisation record: rhoptry and endosomal vacuole and PV during intracellular tachyzoite
  • Other genes localised in this publication: Rhoptry kinase family protein ROP2A (incomplete catalytic triad)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11145

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • NCLIV_069550 Cathepsin B-like protease (Precursor), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_049670 cysteine proteinase, putative
MEKMEGRKSFRVLGTPLPVAALAAILLLGCMYTRAAGTPDDSLFPLSEDTSVDPRESFSAEDVLNAFVSPESVESLFASI
VAEQVVATSGNLTESAPRDRDSAPERRSDGGTLRGHPEDAGELLRLLLADSEDMELWKANFFRHLTHSMRHIVRDSVLVS
EKAFPSEQADEAGRDPGDLKKALKETGEDVFWESRPASSNAAVALIKRKMEKQAGKTGEGAGHTWEPEVSLRFRYLSLKD
AKKLMGTFLVNTKVEGFPTPKGMPLPAKEFENATEPVPAHFDARTAFPACKDVVGHVRDQGDCGSCWAFASTEAFNDRLC
IRSQGKGLMPLSAQHTTSCCNAIHCASFGCNGGQPGMAWRWFERKGVVTGGDFDALGKGTTCWPYEVPFCAHHAKAPFPD
CDATLVPRKTPKCRKDCEEQAYADNVHPFDQDTHKATSAYSLRSRDDVKRDMMTHGPVSGAFMVYEDFLSYKSGVYKHVS
GLPVGGHAIKIIGWGTENGEEYWHAVNSWNTYWGDGGQFKIAMGQCGIDGEMVAGEAAWQETEGVVNGEEELPGQHASGA
RVGAHAEEEREM

Gene-Specific Links for TGME49_049670

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins