ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_049590 ()

proteasome subunit alpha type 5, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11012

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF07_0112 proteasome subunit alpha type 5, putative
  • PBANKA_021150 proteasome subunit alpha type 5, putative
  • PY02094 proteasome subunit alpha type 5
  • PVX_081675 proteasome subunit alpha type 7-2, putative
  • PCHAS_020990 proteasome subunit alpha type 5, putative
  • PKH_021180 proteasome subunit alpha type 5, putative
  • TGME49_049590 proteasome subunit alpha type 5, putative
  • NCLIV_065750 Alpha 2 subunit of 20S proteasome (ISS), related
  • cgd5_1820 proteasome subunit alpha type 5
  • Chro.50200 proteasome subunit alpha type 5
  • CMU_040010 proteasome subunit alpha type 5, putative
  • TP01_1231 proteasome subunit alpha type 5, putative
  • TA20200 proteasome subunit alpha type 5-2, putative
  • BBOV_I001480 proteasome alpha 5 subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_049590 proteasome subunit alpha type 5, putative
MFSTRSEYDRGVNTFSPEGRLFQVEYALGAIKLGSTAVGIQTKDGVILASERRITSCLLDHRSIQKIVEIDDHIACAMSG
LIADARTLIDHARVECANHFFTYNEKMSIHSCIDSVADLALDFSDVSDGRRKKMMSRPFGVALLVAGVDDQGPSLWCADP
SGTVTKYQAVAIGSAQEGAETMLQEQYSQSMSFEDAEALVLVVLRQVMEEKLNCNNVEVACVKTSDRKYHQYSSEELQAL
IDRLPAPTIPTATDLSSA

Gene-Specific Links for TGME49_049590

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins