ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_049370 ()

translation initiation factor SUI1, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10813

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL2095w translation initiation factor SUI1, putative
  • PBANKA_145690 translation initiation factor SUI1, putative
  • PY01209 translation initiation factor SUI1
  • PVX_101080 translation initiation factor SUI1, putative
  • PCHAS_145920 translation initiation factor SUI1, putative
  • PKH_146070 translation initiation factor SUI1, putative
  • TGME49_049370 translation initiation factor SUI1, putative
  • TGME49_086090 translation initiation factor SUI1, putative
  • NCLIV_014350 hypothetical protein
  • NCLIV_065570 translation initiation factor SUI1, putative
  • cgd2_820 putative translation initiation factor 1 (eIF1), SUI1p
  • Chro.20093 translation initiation factor SUI1
  • CMU_009560 translation initiation factor SUI1, putative
  • TA09235 translation initiation factor (SUI1 homologue), putative
  • BBOV_III003030 translation initiation factor SUI1, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_049370 translation initiation factor SUI1, putative
MIEAHPRSRRSPGEKTSFRPCFEEWNGVWTTPMFRISALSIRLIGFAFPSQQLEPEAEVTFDAHLANWLVTSFRTRLARN
RETRSLPLVKGTATRDKSGAIILLATRSAFWPSTAHVFVAAQRVAKAFVSVCRSDSWTSFAASVFSVSSRDCLERFYLLL
TATKNESRFSKEAAIFFFDAQKQLGAFRPCLSQDFLMSVEVHNFGISDPFANDTSQFSVGGSSTHLIHIRNQQRNGRKSV
TTVQGLDKALDLKKMVRALKKELNCNGTVIEDADYGSVIQLQGDQRHAVKEFLEREAICLGEQIRIHGA

Gene-Specific Links for TGME49_049370

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins