ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_049270 ()

thioredoxin, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11189

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0352 protein disulfide isomerase
  • PBANKA_091430 protein disulfide isomerase related protein, putative
  • PY06980 Thioredoxin, putative
  • PVX_092315 protein disulfide isomerase, putative
  • PCHAS_093170 protein disulfide isomerase related protein, putative
  • PKH_093200 protein disulfide-isomerase, putative
  • TGME49_049270 thioredoxin, putative
  • NCLIV_065470 hypothetical protein
  • cgd7_4080 protein disulfide isomerase, signal peptide, ER retention motif
  • Chro.70453 protein disulfide isomerase-related protein (provisional)
  • CMU_014210 protein disulfide-isomerase domain-containing protein
  • TP01_0863 protein disulfide isomerase, putative
  • TA06075 protein disulfide isomerase (thioredoxin), putative
  • BBOV_IV009100 protein disulfide isomerase related protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_049270 thioredoxin, putative
MALAQTQHLALLLAVLSVLTGAQAGLYAPNGPVKVLSGQQFKEQVVGSNDLFIVEFYADWCGHCQRFAPEFEKAAKALRG
IVTLVAVSDQSAMGEYGVQGFPTVKAFVGRGGKPPKTFDYNQGRDAASLIEFAVMHAGKLARARLAGKIDAGTDAKPSEK
AGSPEKETSDVIELTDGNFNQLVMKDDKSVWFVEFYAPWCGHCKALAPTWEEVATALKGKVKVGKVDATVEKVLASTYGI
RGFPTLKLFPAGEKSVGLVKDYEGARTTEALLKYAMEFFSVNVTTEQLLNESQFRKACGDQLCVLAFLPHILDSKTEKRN
EYLATLNRVVRASFHMPIAFFWSQGGDQYEFEEQLNLAFGYPAVVAVHLSKGKYAIHRGDFSQESINTFLTQLLAGKAPI
SELPKNLKKLEESRAWDGKDEELPKDEL

Gene-Specific Links for TGME49_049270

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins