ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_049180 ()

bifunctional dihydrofolate reductase / thymidylate synthase, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10927

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFD0830w bifunctional dihydrofolate reductase-thymidylate synthase
  • PBANKA_071930 bifunctional dihydrofolate reductase-thymidylate synthase, putative
  • PY04370 thymidylate synthase, putative
  • PVX_089950 bifunctional dihydrofolate reductase-thymidylate synthase 1, putative
  • PCHAS_072830 bifunctional dihydrofolate reductase-thymidylate synthase, putative
  • PKH_052130 bifunctional dihydrofolate reductase-thymidylate synthase, putative
  • TGME49_049180 bifunctional dihydrofolate reductase / thymidylate synthase
  • NCLIV_065390 Bifunctional dihydrofolate reductase-thymidylate synthase, related
  • cgd4_4460 dihydrofolate reductase-thymidylate synthase
  • Chro.40506 chain A, crystal structure of Dhfr
  • CMU_010300 thymidylate synthase family protein
  • TA08775 bifunctional dihydrofolate reductase/thymidilate synthase, putative
  • BBOV_II000780 dihydrofolate reductase/thymidylate synthase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_049180 bifunctional dihydrofolate reductase / thymidylate synthase
MQKPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEEASRLNGWLPRKFAKTGDSGLPSPSVGKRFNAVVMG
RKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAA
LSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKSTAAQAAAPAESVFVPFCPELGREKDNEATYRPIFISKTFSDNG
VPYDFVVLEKRRKTDDAATAEPSNAMSSLTSTRETTPVHGLQAPSSAAAIAPVLAWMDEEDRKKREQKELIRAVPHVHFR
GHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGV
KIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAA
LDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEAL
KEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV

Gene-Specific Links for TGME49_049180

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins