ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_048880 (Rab7)

Ras family domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
late endosome during 24 hours after tachyzoite infection

Who localised this protein by microscopy?

Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B.
Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

late endosome during 24 hours after tachyzoite infection

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11035

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_048880 Ras family domain-containing protein
MPGQQERERPERLLRHRVHAERKMARREKQQHRGETKGNSAEALVSLFAISEKAPGRSSIYASGDFARTPARSVSRVSGH
PRLCVCVGAVRASRLCCSRTPEKTLQKQVEELPQGSLGLPGLARRSLRRFFCALKRNARSFKASLLTSASFAPARRRLSQ
SCRQCVSVVGRGAGLGGSAAEKLQRLRENVLGLRFSATPFEGLLFGFGLRIGLSSLAPHGFCMPPKKKALLKVIILGDSG
VGKTSLMNQYVNKKFSNQYKATIGADFLTKDVVIDDKEVTVQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTNPKSFES
LQSWKEEFLIQSSPSDPDSFPFVVVGNKVDEREKRRVSSSKAEAFCRQSGNDIPYFETSAKTATNVHLAFEEIAKRAMLQ
EKQQEQIYLPETLTLSNADIRPAPIDSSGGCC

Gene-Specific Links for TGME49_048880

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins