ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_048830 (PI-PLC) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

phospholipase C delta 1, a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during tachyzoite

Who localised this protein by microscopy?

Fang, J., Marchesini, N., Moreno, S. N.
A Toxoplasma gondii phosphoinositide phospholipase C (TgPI-PLC) with high affinity for phosphatidylinositol. (2006 Mar 1, Biochem J) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "Indirect immunofluorescence analysis using an affinity-purified antibody against TgPI-PLC revealed that this enzyme localizes in the plasma membrane of the parasites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AY304575.1, annotation matches, gene model inconsistent
  • Localisation record: plasma membrane during tachyzoite
  • Other genes localised in this publication: SRS29B (= SAG1, P30)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14306

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF10_0132 phosphoinositide specific phospholipase c, putative
  • PBANKA_121190 phosphoinositide specific phospholipase c, putative
  • PY04833 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1 (ec 3.1.4.11) (plc-delta-1) (phospholipase c-delta-1) (plc-iii) (fragment). [bovine
  • PY05133 hypothetical protein
  • PVX_094895 phospholipase C-like, putative
  • PCHAS_121260 phosphoinositide specific phospholipase c, putative
  • PKH_081300 phospholipase C-like, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_048830 phospholipase C delta 1
MERQTSSSSSSSRLAFLSGSRRFSKKREESPVCGEATTETPQNGEGTPVSRPPTASTGGSSEAVTPQAQNNAVRPAAALP
SARKSLLSGEEGERAASLFALPSQGRQGSGAVVSQRIKDLLADVDTREALQTLAEGSFLLKWCKTNFKKPHERFFYVDAN
AMALKWRSPKKPESVTTIPVGDVQRIIPGEDTDFGRNKADKSHSIEIVATGRVLHVACRDEKEWRLWMKGLLLYHDMALG
QLASEGASDFVSAQWHAVEKDADGKIDQRHLHGLLRKLNIQADGRYVEELFQTHDTENSGRLGFTEFREMLNELLVRPDV
DYYFTVYKLPHEDFIDEQGYRRFLREVQKVTSEAEVEEELASFCSVDEAFRKPGPTVMVSSLGFDNLLCGEANSLMTPHR
MKVHQDMSLPLCNYWVKSSHNTYLCGDQVVGKSAVGQYIDALLRGCRCVELDCWDGSDGEPSLFHGVGGYQLTSRIKFKD
VIQACKDYGFQRSKFPIILSLEMHCSTKQRIRIAEILEEILQDQIYRCHPTSPQPSPEQLLCKFILKGKVPNERGEMVEE
GDEEDLQLEELELRMAKSLEMLGDGQQLNADISSSFVHALEGQGTLLSLPDTPPGLSISQLSSSSLATAEAPEAEPRGRE
GEEVSPLASLSREEERGTSDPKANRLSSSPTSKSKKNRNLFLKKSSSFTCAISARSRLPSAQSQEAPQPISEETPRKRRE
DSRAASVEWRRARTVDRLHEETRENERRGPYLPEAETEHAGGKTKRGKSAAATPGAASADSKSERLKTYYRNIAMPGKKL
RSFEQARNPMDICSMPESRLLKLVKQSPVEFASFNQRFLTRVYPAGTRLQSSNFSPVVPWLFGAQVVALNLQSLGSATIL
NEGRFLDNGGPAGGYVLKPEMMRNPARPFVPAFAELSACRETPVHFTIKILSAHQLPRPVTDPWKGPSTINKIKTRKSTD
LSCPFVSVSIHGVKEDTKAFRTPTVMNNGFNPRWSSPESTFEFIVHAPSVALLMFKVQTADSVRSEFLAAACFPFDAIRP
GIRWVPLFDRKFCRLRWTGLLVYSRIVPLERDDATNTWNPAVSFQDENTPPPPGALV

Gene-Specific Links for TGME49_048830

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins