ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_048810 (NF7)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and nucleus during intracellular tachyzoite

Who localised this protein by microscopy?

Olguin-Lamas, A., Madec, E., Hovasse, A., Werkmeister, E., Callebaut, I., Slomianny, C., Delhaye, S., Mouveaux, T., Schaeffer-Reiss, C., Van Dorsselaer, A., Tomavo, S.
A novel Toxoplasma gondii nuclear factor TgNF3 is a dynamic chromatin-associated component, modulator of nucleolar architecture and parasite virulence. (2011 Mar, PLoS Pathog) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_19074

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_048810 hypothetical protein
MTVATLFPKEEGVGFSLTTQSHGECKVRVDLPSSISQADWERIFSSRMFQDWLSVYATADRLRLLRVALESSQHCKSSGE
EKLTSVAMLVEAADKEGEVFSGPVYLRPQRRAVLVLLRNTETRTDMCLFVKKPNLSVGLADTLELPEGEFEAETGRFVGP
AAEEVERQLEATIYEKNLVNLTQVTFGGGGLALGGDLSFASLSHDGKANNASQEKSPHVAVGLSGGERVELYLYRANVSP
ETMAGIEARVGRLRRRGKQTPEVTTHKPGQSGVQLSLVQLGDAWGLVADAPAVSALFLVHELRYHRLMPKYRNPLAESSE
EAKTSRPVQKAAATFKSVQDLEPTSKGLNLRVKVVSPKVVDRDRTFPSGRTSREGHMVVGDESAVITLKLVDQQMELPDV
EGTPLLIRNGLISMEEGHMKLVVDRWGKIISDIPEAEKESFNFTVNSARDMSATEYELVVLKEDGEEGESGAAPGGGRGR
GGRGRGRGRRGLGRGRR

Gene-Specific Links for TGME49_048810

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins