ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_048670 (VP1, V-H+-PPase, VP-1)

H+-translocating inorganic pyrophosphatase TVP, putative, a gene from Toxoplasma gondii

Compiled localisation
apical during extracellular tachyzoite and intracellular tachyzoite
invasion furrow during tachyzoite invasion
acidocalcisome during extracellular tachyzoite and intracellular tachyzoite and tachyzoite
not dense granule during tachyzoite
cytoplasmic vesicle and parasite plasma membrane during tachyzoite
vacuole and vesicle during extracellular tachyzoite
plant-like vacuole during 24 hours after tachyzoite infection and extracellular tachyzoite
adjacent to the plant-link vacuole during 24 hours after tachyzoite infection

Who localised this protein by microscopy?

Francia, M. E., Wicher, S., Pace, D. A., Sullivan, J., Moreno, S. N., Arrizabalaga, G.
A Toxoplasma gondii protein with homology to intracellular type Na/H exchangers is important for osmoregulation and invasion. (2011 Jun 10, Exp Cell Res) PubMed / full text
   more detail about this publication

acidocalcisome and plant-like vacuole during extracellular tachyzoite
  • "TgNHE3 (red) localizes to the PLV/VAC as represented by TgVP1 (green) in extracellular tachyzoites of T. gondii."
  • Microscopy type: fixed light, EM
  • Microscopy method: antibody
  • Strain: RH HPT-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Acidocalcisomes and PLV/VAC during extracellular tachyzoite
  • Other genes localised in this publication: sodium/hydrogen exchanger, putative, cathepsin L-like thiolproteinase, putative

Rooney, P. J., Ayong, L., Tobin, C. M., Moreno, S. N., Knoll, L. J.
TgVTC2 is involved in polyphosphate accumulation in Toxoplasma gondii. (2011 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

acidocalcisome during intracellular tachyzoite

Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B.
Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

adjacent to the plant-link vacuole and plant-like vacuole during 24 hours after tachyzoite infection

Miranda, K., Pace, D. A., Cintron, R., Rodrigues, J. C., Fang, J., Smith, A., Rohloff, P., Coelho, E., de Haas, F., de Souza, W., Coppens, I., Sibley, L. D., Moreno, S. N.
Characterization of a novel organelle in Toxoplasma gondii with similar composition and function to the plant vacuole. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

vacuole and vesicle during extracellular tachyzoite
  • "Immunofluorescence analysis (IFA) of extracellular tachyzoites with one of these antibodies shows labeling of a large vacuolar structure also clearly observable by differential interference contrast (DIC) microscopy (Fig. 1 and 1B). This enzyme was previously localized to the acidocalcisomes (Rodrigues et al., 2000) and vesicles labeled with the antibody are observed in all preparations with both antibodies (see Fig. S1A, arrows)."
  • Microscopy type: light, EM
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: blast from AAK38077.1, annotation matches, taken directly from publication
  • Localisation record: vacuole and vesicles during extracellular tachyzoite
  • Other genes localised in this publication: cathepsin L-like thiolproteinase, putative, aquaporin

Bottova, I., Sauder, U., Olivieri, V., Hehl, A. B., Sonda, S.
The P-glycoprotein inhibitor GF120918 modulates Ca2+-dependent processes and lipid metabolism in Toxoplasma gondii. (2010, PLoS One) PubMed / full text
   more detail about this publication

acidocalcisome during extracellular tachyzoite
  • "Co-immunostaining with antibodies against the acidocalcisome marker VP1 [33] revealed that both proteins are indeed present in the same structures (Fig. 5C)."
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: acidocalcisomes during extracellular tachyzoite
  • Other genes localised in this publication: ATP-binding cassette protein subfamily B member 1

Breinich, M. S., Ferguson, D. J., Foth, B. J., van Dooren, G. G., Lebrun, M., Quon, D. V., Striepen, B., Bradley, P. J., Frischknecht, F., Carruthers, V. B., Meissner, M.
A dynamin is required for the biogenesis of secretory organelles in Toxoplasma gondii. (2009 Feb 24, Curr Biol) PubMed / full text
   more detail about this publication

vacuole
  • "We were not able to colocalize DrpB with markers of the secretory pathway, such as the cis-medial Golgi marker GRASP-RFP [20], the trans-Golgi marker UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T1 fused to yellow fluorescent protein (YFP) (TgGalNac-YFP; M. Nishi and D.S. Roos, personal communication) [4], the propeptide of M2AP (a precursor microneme protein that localizes in endosome-related compartments) [4], VP-1 (a vacuolar proton pyrophosphatase) [4], or the μ1 chain of the adaptin-1 complex 3."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH hxgprt−
  • Gene model mapping comments: inferred from another publication
  • Localisation record: vacuole
  • Other genes localised in this publication: dynamin-like protein, putative, mu1 adaptin, MIC2-associated protein M2AP, microneme protein 8

Drozdowicz, Y. M., Shaw, M., Nishi, M., Striepen, B., Liwinski, H. A., Roos, D. S., Rea, P. A.
Isolation and characterization of TgVP1, a type I vacuolar H+-translocating pyrophosphatase from Toxoplasma gondii. The dynamics of its subcellular localization and the cellular effects of a diphosphonate inhibitor. (2003 Jan 10, J Biol Chem) PubMed / full text
   more detail about this publication

apical during extracellular tachyzoite and intracellular tachyzoite, invasion furrow during tachyzoite invasion
  • "Immunofluorescence microscopy of both free and intracellular T. gondii tachyzoites using purified universal V-PPase polyclonal antibodies reveals a punctate apical distribution for the enzyme. Equivalent studies of the tachyzoites during host cell invasion, by contrast, disclose a transverse radial distribution in which the V-PPase is associated with a collar-like structure that migrates along the length of the parasite in synchrony with and in close apposition to the penetration furrow."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: RH
  • Gene model mapping comments: Blast from AF320281
  • Localisation record: punctate apical during free tachyzoite and intracellular tachyzoite, invasion furrow during tachyzoite invasion
  • Other genes localised in this publication: -

Luo, S., Vieira, M., Graves, J., Zhong, L., Moreno, S. N.
A plasma membrane-type Ca(2+)-ATPase co-localizes with a vacuolar H(+)-pyrophosphatase to acidocalcisomes of Toxoplasma gondii. (2001 Jan 15, EMBO J) PubMed / full text
   more detail about this publication

acidocalcisome and not dense granule during tachyzoite
  • "We also report, for the first time, the localization of the V-H+-PPase to the acidocalcisomes of T.gondii."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody to homologue
  • Strain: RH
  • Gene model mapping comments: Blast from epitope CNTGGAWDNAKKYIEKGGLRDKKGKGS, annotation matches
  • Localisation record: acidocalcisomes and not dense granule during tachyzoite
  • Other genes localised in this publication: Ca2+-ATPase, 28 kDa antigen

Rodrigues, C. O., Scott, D. A., Bailey, B. N., De Souza, W., Benchimol, M., Moreno, B., Urbina, J. A., Oldfield, E., Moreno, S. N.
Vacuolar proton pyrophosphatase activity and pyrophosphate (PPi) in Toxoplasma gondii as possible chemotherapeutic targets. (2000 Aug 1, Biochem J) PubMed / full text
   more detail about this publication

cytoplasmic vesicle and parasite plasma membrane during tachyzoite
  • "Immunofluorescence microscopy, using antisera raised against conserved peptide sequences of a plant vacuolar pyrophosphatase, suggested that the pyrophosphatase in T. gondii tachyzoites was located in the plasma membrane and intracellular vacuoles of the parasite."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to homologue
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasmic vesicles and plasma membrane during tachyzoite
  • Other genes localised in this publication: -

Moreno, S. N., Zhong, L., Lu, H. G., Souza, W. D., Benchimol, M.
Vacuolar-type H+-ATPase regulates cytoplasmic pH in Toxoplasma gondii tachyzoites. (1998 Mar 1, Biochem J) PubMed / full text
   more detail about this publication

cytoplasmic vesicle and parasite plasma membrane during tachyzoite
  • "Confocal laser scanning microscopy indicated that, in addition to being located in cytoplasmic vacuoles, the vacuolar (V)-H+-ATPase of T. gondii tachyzoites is also located in the plasma membrane. Surface localization of the V-H+-ATPase was confirmed by experiments using biotinylation of cell surface proteins and immunoprecipitation with antibodies against V-H+-ATPases."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to homologue
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasmic vesicles and plasma membrane during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12221

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_132050 V-type H( )-translocating pyrophosphatase, putative
  • PBANKA_144980 inorganic pyrophosphatase, putative
  • PY00513 vacuolar-type H+ pumping pyrophosphatase-related
  • PY06858 V-type H(+)-translocating pyrophosphatase
  • PVX_100710 vacuolar-type H+ pumping pyrophosphatase, putative
  • PVX_117625 V-type H(+)-translocating pyrophosphatase, putative
  • PCHAS_132380 V-type H( )-translocating pyrophosphatase, putative
  • PCHAS_145210 inorganic pyrophosphatase, putative
  • PKH_124930 V-type H( )-translocating pyrophosphatase, putative
  • PKH_145370 vacuolar-type H -translocating inorganic pyrophosphatase, putative
  • NCLIV_064810 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_048670 H+-translocating inorganic pyrophosphatase TVP, putative
MGGRRRSFFLSTAGALAPAVATTTVSLIVLSSSFPLLSSSSPESEGDRFQVTAATRDVPEEASVAASRELSEEDATLRID
KATTCLLLLPSIIGLFWAVYEAWKVSKIQMDGPLGDDNKRLTDPLYLEMSGNIQQQLNMMKSISRCIADGAITFLTQEFK
YMAVYIVVFSSILGIFVGIPTMAAFVLGALTSILCGFVGMKIAVYSNVRTCHEAWMELGRGFQVALTAGSVMGFALVSLG
CLTLVAIILLYRLPSLFGTNPEDQRALFEAVAGYGLGGSSIALFARVGGGIYTKAADVGADLSGKNEYGMSEDDPRNPAC
IADNVGDNVGDVAGMGADLFGSLAEASCAGLVIAGASIATSASGGPQGLAHSWSGLMFPVLISSTGIFTGIFTVVLVRAC
FSVRCYDDIEKALKWVMFISTGLEMPVLILLSYFFLPSEFLLDGCQGTTAWWHAAVCVVLGLWAGLAIGYVTEYYTSHSY
FPVREISQTQIVSAATGIIYGLALGYSSTVVPIICLGVTILVSHTLCGMYGIALAALGMLSTLTMGLMIDGYGPISDNAG
GIAEMAGLGPEVRSRTDALDAAGNTTAAVGKGYAIGSAALVSLALFGAFTVRAHITAVDVLDPWTFTGLLFGAMMPYAFS
AMTMKSVGIAASDMVQECLQQFPLIIQGNIEPQYKRCIEISTRASLHEMIAPGALVICAPVAAGMMFGKNCTAGLLAGAL
VSGIQLAISASTSGSAWDNAKKYIESGALGADHGKGSQAHKNAVTGDTVGDPLKDTSGPSLNILIKLSAIISLVFGAFIA
EHFSNAQGGPAWVRVL

Gene-Specific Links for TGME49_048670

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins